HORDB

ID: hor006728
Uniprot ID: P30983
Protein name: Glycoprotein hormones alpha chain
Gene name: cga
Organism: Ctenopharyngodon idella (Grass carp) (Leuciscus idella)
Family: Glycoprotein hormones subunit alpha family
Source: Animal
Expression: NA
Disease: NA
Comments: NA
Taxonomy: Ctenopharyngodon (genus), Xenocypridinae (subfamily), Xenocyprididae (family), Cyprinoidei (suborder), Cypriniformes (order), Cypriniphysae (superorder), Otophysi , Ostariophysi (subcohort), Otomorpha (cohort), Clupeocephala , Osteoglossocephalai , Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
GO MF: GO:0005179 hormone activity; GO:0016913 follicle-stimulating hormone activity
GO BP: GO:0007186 G protein-coupled receptor signaling pathway; GO:0010469 regulation of signaling receptor activity; GO:0010893 positive regulation of steroid biosynthetic process
GO CC: GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0016914 follicle-stimulating hormone complex

Sequence: YPRNDMTNFGCEECKLKENNIFSKPGAPVYQCMGCCFSRAYPTPLRSKKTMLVPKNITSEATCCVAKEVKRVLVNDVKLVNHTDCHCSTCYYHKS
Length: 95(24-118)
Propeptide: MFWTRYAGASILLFLMLIHLGQVYPRNDMTNFGCEECKLKENNIFSKPGAPVYQCMGCCFSRAYPTPLRSKKTMLVPKNITSEATCCVAKEVKRVLVNDVKLVNHTDCHCSTCYYHKS
Signal peptide: MFWTRYAGASILLFLMLIHLGQV
Modification: NA
Glycosylation: T56 N-linked (GlcNAc...) asparagine;T81 N-linked (GlcNAc...) asparagine
Mutagenesis: NA

Function: Shared alpha chain of heterodimeric glycoprotein hormones. These hormones bind specific receptors on target cells that in turn activate downstream signaling pathways. Involved in gametogenesis and steroidogenesis.
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
Kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor006728_AF2.pdb

hor006728_ESM.pdb

Mass:	1246639	Formula:	C465H739N131O138S13
Absent amino acids:	W	Common amino acids:	CK
pI:	8.56	Basic residues:	17
Polar residues:	38	Hydrophobic residues:	22
Hydrophobicity:	-43.89	Boman Index:	-17487
Half-Life / Aliphatic Index:	2.8 hour	Aliphatic Index:	57.37
Instability Index:	5086.32	Extinction Coefficient cystines:	8075
Absorbance 280nm:	85.9