General Information

  • ID:  hor006727
  • Uniprot ID:  P30971
  • Protein name:  Gonadotropin subunit beta-1
  • Gene name:  cgba
  • Organism:  Fundulus heteroclitus (Killifish) (Mummichog)
  • Family:  Glycoprotein hormones subunit beta family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Fundulus (genus), Fundulidae (family), Cyprinodontoidei (suborder), Cyprinodontiformes (order), Atherinomorphae (superorder), Ovalentaria , Percomorphaceae , Euacanthomorphacea , Acanthomorphata , Ctenosquamata , Eurypterygia , Neoteleostei , Euteleosteomorpha (cohort), Clupeocephala , Osteoglossocephalai , Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  CHLKNVSIPMERCGQRVCIHTTICEGLCFSEDAVFESPDEAPEHRVCNGDWSYEVKHIQGCPESITYPVATNCYCSACNTKDTYCTRLYAHIPSC
  • Length:  95
  • Propeptide:  MQLVLMAAVLALAEVGCFGCHLKNVSIPMERCGQRVCIHTTICEGLCFSEDAVFESPDEAPEHRVCNGDWSYEVKHIQGCPESITYPVATNCYCSACNTKDTYCTRLYAHIPSC
  • Signal peptide:  MQLVLMAAVLALAEVGCFG
  • Modification:  NA
  • Glycosylation:  T5 N-linked (GlcNAc...) asparagine
  • Mutagenesis:  NA

Activity

  • Function:  Involved in gametogenesis and steroidogenesis.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  1-47; 13-61; 18-95; 24-73; 28-75; 78-85
  • Structure ID:  AF-P30971-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006727_AF2.pdbhor006727_ESM.pdb

Physical Information

Mass: 1235793 Formula: C455H695N127O145S13
Absent amino acids: Common amino acids: C
pI: 5.47 Basic residues: 12
Polar residues: 39 Hydrophobic residues: 23
Hydrophobicity: -29.16 Boman Index: -16179
Half-Life: 1.2 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 60.53
Instability Index: 5105.05 Extinction Coefficient cystines: 13700
Absorbance 280nm: 145.74

Literature

  • PubMed ID:  1526312
  • Title:  Fundulus heteroclitus gonadotropins. 3. Cloning and sequencing of gonadotropic hormone (GTH) I and II beta-subunits using the polymerase chain reaction.