General Information

  • ID:  hor006726
  • Uniprot ID:  P30970
  • Protein name:  Glycoprotein hormones alpha chain
  • Gene name:  cga
  • Organism:  Acanthopagrus latus (Yellowfin seabream) (Sparus latus)
  • Family:  Glycoprotein hormones subunit alpha family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Acanthopagrus (genus), Sparidae (family), Spariformes (order), Eupercaria , Percomorphaceae , Euacanthomorphacea , Acanthomorphata , Ctenosquamata , Eurypterygia , Neoteleostei , Euteleosteomorpha (cohort), Clupeocephala , Osteoglossocephalai , Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0016913 follicle-stimulating hormone activity
  • GO BP:  GO:0007186 G protein-coupled receptor signaling pathway; GO:0010469 regulation of signaling receptor activity; GO:0010893 positive regulation of steroid biosynthetic process
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0016914 follicle-stimulating hormone complex

Sequence Information

  • Sequence:  YPNTDLSNMGCEACTLRKNTVFSRDRPIYQCMGCCFSRAYPTPLKAMKTMTIPKNITSEATCCVAKHVYETEVAGIRVRNHTDCHCSTCYYHKI
  • Length:  94
  • Propeptide:  MGSVKSAGLSLLLLSFLLYVADSYPNTDLSNMGCEACTLRKNTVFSRDRPIYQCMGCCFSRAYPTPLKAMKTMTIPKNITSEATCCVAKHVYETEVAGIRVRNHTDCHCSTCYYHKI
  • Signal peptide:  MGSVKSAGLSLLLLSFLLYVADS
  • Modification:  NA
  • Glycosylation:  T55 N-linked (GlcNAc...) asparagine;T80 N-linked (GlcNAc...) asparagine
  • Mutagenesis:  NA

Activity

  • Function:  Shared alpha chain of heterodimeric glycoprotein hormones. These hormones bind specific receptors on target cells that in turn activate downstream signaling pathways. Involved in gametogenesis and steroidogenesis.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  11-34; 14-63; 31-84; 35-86; 62-89
  • Structure ID:  AF-P30970-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor006726_AF2.pdbhor006726_ESM.pdb

Physical Information

Mass: 1235340 Formula: C456H722N132O137S14
Absent amino acids: W Common amino acids: TC
pI: 8.41 Basic residues: 16
Polar residues: 40 Hydrophobic residues: 21
Hydrophobicity: -35.64 Boman Index: -17831
Half-Life: 2.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: 2 min Aliphatic Index 55
Instability Index: 4108.19 Extinction Coefficient cystines: 9565
Absorbance 280nm: 102.85

Literature

  • PubMed ID:  NA
  • Title:  NA