General Information

  • ID:  hor006722
  • Uniprot ID:  P18857
  • Protein name:  Glycoprotein hormones alpha chain 2
  • Gene name:  cgab
  • Organism:  Cyprinus carpio (Common carp)
  • Family:  Glycoprotein hormones subunit alpha family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Cyprinus (genus), Cyprininae (subfamily), Cyprinidae (family), Cyprinoidei (suborder), Cypriniformes (order), Cypriniphysae (superorder), Otophysi , Ostariophysi (subcohort), Otomorpha (cohort), Clupeocephala , Osteoglossocephalai , Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  YPRNYMNNFGCEECKLKENNIFSKPGAPVYQCMGCCFSRAYPTPLRSKKTMLVPKNITSEATCCVAKEFKQVLVNDIKLVNHTDCHCSTCYYHKS
  • Length:  95
  • Propeptide:  MFWTRYAGASVLLFLMLIHLGQLYPRNYMNNFGCEECKLKENNIFSKPGAPVYQCMGCCFSRAYPTPLRSKKTMLVPKNITSEATCCVAKEFKQVLVNDIKLVNHTDCHCSTCYYHKS
  • Signal peptide:  MFWTRYAGASVLLFLMLIHLGQL
  • Modification:  NA
  • Glycosylation:  T56 N-linked (GlcNAc...) asparagine;T81 N-linked (GlcNAc...) asparagine
  • Mutagenesis:  NA

Activity

  • Function:  Involved in gametogenesis and steroidogenesis.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  11-35; 14-64; 32-85; 36-87; 63-90
  • Structure ID:  AF-P18857-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor006722_AF2.pdbhor006722_ESM.pdb

Physical Information

Mass: 1256149 Formula: C474H740N130O138S13
Absent amino acids: W Common amino acids: CK
pI: 8.56 Basic residues: 16
Polar residues: 39 Hydrophobic residues: 22
Hydrophobicity: -44.63 Boman Index: -16116
Half-Life: 2.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: 2 min Aliphatic Index 55.37
Instability Index: 5377.16 Extinction Coefficient cystines: 9565
Absorbance 280nm: 101.76

Literature

  • PubMed ID:  3246480
  • Title:  Primary structures of carp gonadotropin subunits deduced from cDNA nucleotide sequences.