General Information

  • ID:  hor006716
  • Uniprot ID:  P07108
  • Protein name:  Acyl-CoA-binding protein
  • Gene name:  DBI
  • Organism:  Homo sapiens (Human)
  • Family:  ACBP family
  • Source:  Human
  • Expression:  Isoform 1 is ubiquitous, with a moderate expression level. Isoform 2 is ubiquitous with high level in liver and adipose tissue. Isoform 3 is ubiquitous with strong expression in adipose tissue and heart.
  • Disease:  Diseases associated with DBI include Schizophrenia 14 and Peroxisomal Biogenesis Disorder.
  • Comments:  NA
  • Taxonomy:   Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0000062 fatty-acyl-CoA binding; GO:0008289 lipid binding; GO:0030156 benzodiazepine receptor binding; GO:0036042 long-chain fatty acyl-CoA binding; GO:0042802 identical protein binding
  • GO BP:  GO:0006631 fatty acid metabolic process; GO:0036151 phosphatidylcholine acyl-chain remodeling; GO:1903060 negative regulation of protein lipidation; GO:1905920 positive regulation of CoA-transferase activity; GO:2001140 positive regulation of phospholipid transport
  • GO CC:  GO:0005783 endoplasmic reticulum; GO:0005788 endoplasmic reticulum lumen; GO:0005794 Golgi apparatus; GO:0032994 protein-lipid complex; GO:0070062 extracellular exosome

Sequence Information

  • Sequence:  SQAEFEKAAEEVRHLKTKPSDEEMLFIYGHYKQATVGDINTERPGMLDFTGKAKWDAWNELKGTSKEDAMKAYINKVEELKKKYGI
  • Length:  86(2-87)
  • Propeptide:  MSQAEFEKAAEEVRHLKTKPSDEEMLFIYGHYKQATVGDINTERPGMLDFTGKAKWDAWNELKGTSKEDAMKAYINKVEELKKKYGI
  • Signal peptide:  NA
  • Modification:  T1 N-acetylserine;T7 N6-acetyllysine;T7 N6-succinyllysine;T16 N6-succinyllysine;T18 N6-acetyllysine;T28 Phosphotyrosine;T54 N6-(2-hydroxyisobutyryl)lysine;T54 N6-acetyllysine;T54 N6-malonyllysine;T54 N6-succinyllysine;T76 N6-acetyllysine;T76 N6-succinylly
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Binds medium- and long-chain acyl-CoA esters with very high affinity and may function as an intracellular carrier of acyl-CoA esters. It is also able to displace diazepam from the benzodiazepine (BZD) recognition site located on the GABA type A receptor.
  • Mechanism:  [Isoform 6]: Predominantly expressed in adipose tissue and hippocampus.
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P07108-F1(AlphaFold_DB_ID)/2CB8(PDB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    2cb8.pdbhor006716_AF2.pdbhor006716_ESM.pdb

Physical Information

Mass: 1142955 Formula: C443H690N116O136S3
Absent amino acids: C Common amino acids: K
pI: 6.54 Basic residues: 17
Polar residues: 21 Hydrophobic residues: 25
Hydrophobicity: -93.02 Boman Index: -18726
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 60.23
Instability Index: 3215.7 Extinction Coefficient cystines: 16960
Absorbance 280nm: 199.53

Literature

  • PubMed ID:  3020548
  • Title:  Cloning and expression of cDNA for human diazepam binding inhibitor, a natural ligand of an allosteric regulatory site of the gamma-aminobutyric acid type A receptor.
  • PubMed ID:  2881742
  • Title:  Bovine and human cDNA sequences encoding a putative benzodiazepine receptor ligand.
  • PubMed ID:  16055366
  • Title:  Id
  • PubMed ID:  21698759
  • Title:  
  • PubMed ID:  20345851
  • Title:  
  • PubMed ID:  15815621
  • Title:  
  • PubMed ID:  15489334
  • Title:  
  • PubMed ID:  3525533
  • Title:  
  • PubMed ID:  12665801
  • Title:  
  • PubMed ID:  1292782
  • Title:  
  • PubMed ID:  7534063
  • Title:  
  • PubMed ID:  17953517
  • Title:  
  • PubMed ID:  19413330
  • Title:  
  • PubMed ID:  19608861
  • Title:  
  • PubMed ID:  20068231
  • Title:  
  • PubMed ID:  21269460
  • Title:  
  • PubMed ID:  21908771
  • Title:  
  • PubMed ID:  22814378
  • Title:  
  • PubMed ID:  24275569
  • Title:  
  • PubMed ID:  25944712
  • Title:  
  • PubMed ID:  29192674
  • Title:  
  • PubMed ID:  17044054
  • Title: