HORDB

ID: hor006715
Uniprot ID: P07107
Protein name: Acyl-CoA-binding protein
Gene name: DBI
Organism: Bos taurus (Bovine)
Family: ACBP family
Source: animal
Expression: NA
Disease: NA
Comments: NA
Taxonomy: Bos (genus), Bovinae (subfamily), Bovidae (family), Pecora (infraorder), Ruminantia (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
GO MF: GO:0000062 fatty-acyl-CoA binding; GO:0008289 lipid binding
GO BP: GO:0006631 fatty acid metabolic process
GO CC: GO:0005783 endoplasmic reticulum; GO:0005794 Golgi apparatus

Sequence: SQAEFDKAAEEVKHLKTKPADEEMLFIYSHYKQATVGDINTERPGMLDFKGKAKWDAWNELKGTSKEDAMKAYIDKVEELKKKYGI
Length: 86
Propeptide: MSQAEFDKAAEEVKHLKTKPADEEMLFIYSHYKQATVGDINTERPGMLDFKGKAKWDAWNELKGTSKEDAMKAYIDKVEELKKKYGI
Signal peptide: NA
Modification: T1 N-acetylserine;T7 N6-acetyllysine;T7 N6-succinyllysine;T16 N6-succinyllysine;T18 N6-acetyllysine;T28 Phosphotyrosine;T50 N6-acetyllysine;T54 N6-(2-hydroxyisobutyryl)lysine;T54 N6-acetyllysine;T54 N6-malonyllysine;T54 N6-succinyllysine;T76 N6-acetyllysi
Glycosylation: NA
Mutagenesis: NA

Function: Binds medium- and long-chain acyl-CoA esters with very high affinity and may function as an intracellular carrier of acyl-CoA esters. It is also able to displace diazepam from the benzodiazepine (BZD) recognition site located on the GABA type A receptor. It is therefore possible that this protein also acts as a neuropeptide to modulate the action of the GABA receptor.
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

1aca.pdb

hor006715_AF2.pdb

hor006715_ESM.pdb

Mass:	1142961	Formula:	C445H694N114O136S3
Absent amino acids:	C	Common amino acids:	K
pI:	6.54	Basic residues:	18
Polar residues:	18	Hydrophobic residues:	26
Hydrophobicity:	-93.49	Boman Index:	-18399
Half-Life:	1.9 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	>10 hour	Aliphatic Index	61.4
Instability Index:	2454.19	Extinction Coefficient cystines:	16960
Absorbance 280nm:	199.53

PubMed ID: 2881742
Title: Bovine and human cDNA sequences encoding a putative benzodiazepine receptor ligand.
PubMed ID: 3525533
Title: Complete amino acid sequences of bovine and human endozepines. Homology with rat diazepam binding inhibitor.
PubMed ID: 3663196
Title: Amino acid sequence of acyl-CoA-binding protein from cow liver.
PubMed ID: 1622397
Title: Purification and characterization of variants of acyl-CoA-binding protein in the bovine liver.
PubMed ID: 17953517
Title: Acyl-CoA-binding protein (ACBP) localizes to the endoplasmic reticulum and Golgi in a ligand-dependent manner in mammalian cells.
PubMed ID: 1931985
Title: The secondary structure in solution of acyl-coenzyme A binding protein from bovine liver using 1H nuclear magnetic resonance spectroscopy.
PubMed ID: 1518047
Title: Three-dimensional structure in solution of acyl-coenzyme A binding protein from bovine liver.
PubMed ID: 8358232
Title: The three-dimensional structure of acyl-coenzyme A binding protein from bovine liver: structural refinement using heteronuclear multidimensional NMR spectroscopy.
PubMed ID: 8503960
Title: Three-dimensional structure of the complex between acyl-coenzyme A binding protein and palmitoyl-coenzyme A.
PubMed ID: 11491287
Title: Binding site differences revealed by crystal structures of Plasmodium falciparum and bovine acyl-CoA binding protein.