General Information

  • ID:  hor006714
  • Uniprot ID:  P01221
  • Protein name:  Glycoprotein hormones alpha chain 1
  • Gene name:  cgaa
  • Organism:  Cyprinus carpio (Common carp)
  • Family:  Glycoprotein hormones subunit alpha family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Cyprinus (genus), Cyprininae (subfamily), Cyprinidae (family), Cyprinoidei (suborder), Cypriniformes (order), Cypriniphysae (superorder), Otophysi , Ostariophysi (subcohort), Otomorpha (cohort), Clupeocephala , Osteoglossocephalai , Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0046982 protein heterodimerization activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  YPRNDMNNFGCEECKLKENNIFSKPGAPVYQCMGCCFSRAYPTPLRSKKTMLVPKNITSEATCCVAKEVKRVLVNDVKLVNHTDCHCSTCYYHKS
  • Length:  95
  • Propeptide:  MFWTRYAGASILLFFMLIRLGQLYPRNDMNNFGCEECKLKENNIFSKPGAPVYQCMGCCFSRAYPTPLRSKKTMLVPKNITSEATCCVAKEVKRVLVNDVKLVNHTDCHCSTCYYHKS
  • Signal peptide:  MFWTRYAGASILLFFMLIRLGQL
  • Modification:  NA
  • Glycosylation:  T56 N-linked (GlcNAc...) asparagine;T81 N-linked (GlcNAc...) asparagine
  • Mutagenesis:  NA

Activity

  • Function:  Involved in gametogenesis and steroidogenesis.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  11-35; 14-64; 32-85; 36-87; 63-90
  • Structure ID:  AF-P01221-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor006714_AF2.pdbhor006714_ESM.pdb

Physical Information

Mass: 1247939 Formula: C465H738N132O138S13
Absent amino acids: W Common amino acids: CK
pI: 8.56 Basic residues: 17
Polar residues: 38 Hydrophobic residues: 22
Hydrophobicity: -46.84 Boman Index: -17894
Half-Life: 2.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: 2 min Aliphatic Index 57.37
Instability Index: 5274.84 Extinction Coefficient cystines: 8075
Absorbance 280nm: 85.9

Literature

  • PubMed ID:  3246480
  • Title:  Primary structures of carp gonadotropin subunits deduced from cDNA nucleotide sequences.
  • PubMed ID:  1370380
  • Title:  Organization and nucleotide sequence of carp gonadotropin alpha subunit genes.
  • PubMed ID:  607993
  • Title:  The evolution of gonadotropins: some molecular data concerning a non-mammalian pituitary gonadotropin, the hormone from a teleost fish (Cyprinus carpio L.).