General Information

  • ID:  hor006711
  • Uniprot ID:  P01218
  • Protein name:  LH alpha 1-3
  • Gene name:  CGA
  • Organism:  Ovis aries (Sheep)
  • Family:  Glycoprotein hormones subunit alpha family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Ovis (genus), Caprinae (subfamily), Bovidae (family), Pecora (infraorder), Ruminantia (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0016913 follicle-stimulating hormone activity
  • GO BP:  GO:0007186 G protein-coupled receptor signaling pathway; GO:0010469 regulation of signaling receptor activity; GO:0010893 positive regulation of steroid biosynthetic process
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0016914 follicle-stimulating hormone complex; GO:0061696 pituitary gonadotropin complex

Sequence Information

  • Sequence:  TMQGCPECKLKENKYFSKPDAPIYQCMGCCFSRAYPTPARSKKTMLVPKNITSEATCCVAKAFTKATVMGNVRVENHTECHCSTCYYHKS
  • Length:  90
  • Propeptide:  MDYYRKYAAAILAILSLFLQILHSFPDGEFTMQGCPECKLKENKYFSKPDAPIYQCMGCCFSRAYPTPARSKKTMLVPKNITSEATCCVAKAFTKATVMGNVRVENHTECHCSTCYYHKS
  • Signal peptide:  MDYYRKYAAAILAILSLFLQILHS
  • Modification:  NA
  • Glycosylation:  T50 N-linked (GlcNAc...) asparagine;T76 N-linked (GlcNAc...) asparagine
  • Mutagenesis:  NA

Activity

  • Function:  Shared alpha chain of the active heterodimeric glycoprotein hormones thyrotropin/thyroid stimulating hormone/TSH, lutropin/luteinizing hormone/LH and follitropin/follicle stimulating hormone/FSH. These hormones bind specific receptors on target cells that in turn activate downstream signaling pathways.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  5-29; 8-58; 26-80; 30-82; 57-85
  • Structure ID:  AF-P01218-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006711_AF2.pdbhor006711_ESM.pdb

Physical Information

Mass: 1168642 Formula: C433H685N121O129S14
Absent amino acids: W Common amino acids: CKT
pI: 8.71 Basic residues: 16
Polar residues: 37 Hydrophobic residues: 19
Hydrophobicity: -45.89 Boman Index: -15237
Half-Life: 7.2 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 41.22
Instability Index: 5509.22 Extinction Coefficient cystines: 8075
Absorbance 280nm: 90.73

Literature

  • PubMed ID:  2481272
  • Title:  Cloning and DNA sequence analysis of the cDNA for the common alpha-subunit of the ovine pituitary glycoprotein hormones.
  • PubMed ID:  5064343
  • Title:  The primary structure of ovine luteinizing hormone. I. The amino acid sequence of the reduced and S-aminoethylated S-subunit (LH- ).
  • PubMed ID:  4676903
  • Title:  The primary structure of ovine interstitial cell-stimulating hormone. I. The -subunit.
  • PubMed ID:  6798968
  • Title:  Primary structure of the ovine pituitary follitropin alpha-subunit.
  • PubMed ID:  2456202
  • Title:  Renotropic activity in ovine luteinizing hormone isoform(s).
  • PubMed ID:  2209620
  • Title:  Site-specific N-glycosylation of ovine lutropin. Structural analysis by one- and two-dimensional 1H-NMR spectroscopy.