HORDB

ID: hor006710
Uniprot ID: P01218
Protein name: LH alpha 1-1
Gene name: CGA
Organism: Ovis aries (Sheep)
Family: Glycoprotein hormones subunit alpha family
Source: Animal
Expression: NA
Disease: NA
Comments: NA
Taxonomy: Ovis (genus), Caprinae (subfamily), Bovidae (family), Pecora (infraorder), Ruminantia (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
GO MF: GO:0005179 hormone activity; GO:0016913 follicle-stimulating hormone activity
GO BP: GO:0007186 G protein-coupled receptor signaling pathway; GO:0010469 regulation of signaling receptor activity; GO:0010893 positive regulation of steroid biosynthetic process
GO CC: GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0016914 follicle-stimulating hormone complex; GO:0061696 pituitary gonadotropin complex

Sequence: GEFTMQGCPECKLKENKYFSKPDAPIYQCMGCCFSRAYPTPARSKKTMLVPKNITSEATCCVAKAFTKATVMGNVRVENHTECHCSTCYYHKS
Length: 93(28-120)
Propeptide: MDYYRKYAAAILAILSLFLQILHSFPDGEFTMQGCPECKLKENKYFSKPDAPIYQCMGCCFSRAYPTPARSKKTMLVPKNITSEATCCVAKAFTKATVMGNVRVENHTECHCSTCYYHKS
Signal peptide: MDYYRKYAAAILAILSLFLQILHS
Modification: NA
Glycosylation: T53 N-linked (GlcNAc...) asparagine;T79 N-linked (GlcNAc...) asparagine
Mutagenesis: NA

Function: Shared alpha chain of the active heterodimeric glycoprotein hormones thyrotropin/thyroid stimulating hormone/TSH, lutropin/luteinizing hormone/LH and follitropin/follicle stimulating hormone/FSH. These hormones bind specific receptors on target cells that
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor006710_AF2.pdb

hor006710_ESM.pdb

Mass:	1207327	Formula:	C449H704N124O134S14
Absent amino acids:	W	Common amino acids:	CKT
pI:	8.56	Basic residues:	16
Polar residues:	38	Hydrophobic residues:	20
Hydrophobicity:	-45.59	Boman Index:	-15526
Half-Life:	30 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	>10 hour	Aliphatic Index	39.89
Instability Index:	5282.69	Extinction Coefficient cystines:	8075
Absorbance 280nm:	87.77

PubMed ID: 2481272
Title: Cloning and DNA sequence analysis of the cDNA for the common alpha-subunit of the ovine pituitary glycoprotein hormones.
PubMed ID: 5064343
Title: The primary structure of ovine luteinizing hormone. I. The amino acid sequence of the reduced and S-aminoethylated S-subunit (LH- ).#
PubMed ID: 4676903
Title:
PubMed ID: 6798968
Title:
PubMed ID: 2456202
Title:
PubMed ID: 2209620
Title: