HORDB

ID: hor006703
Uniprot ID: O46202
Protein name: Accessory gland protein Acp62F
Gene name: Acp62F
Organism: Drosophila melanogaster (Fruit fly)
Family: NA
Source: Animal
Expression: Produced in the male genital tract (at protein level) .
Disease: NA
Comments: NA
Taxonomy: melanogaster subgroup , melanogaster group , Sophophora (subgenus), Drosophila (genus), Drosophilini (tribe), Drosophilinae (subfamily), Drosophilidae (family), Ephydroidea (superfamily), Acalyptratae , Schizophora , Cyclorrhapha , Eremoneura , Muscomorpha (infraorder), Brachycera (suborder), Diptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia , Insecta (class), Hexapoda (subphylum), Pancrustacea , Mandibulata , Arthropoda (phylum), Panarthropoda , Ecdysozoa , Protostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
GO MF: GO:0004867 serine-type endopeptidase inhibitor activity
GO BP: GO:0007610 behavior; GO:0019953 sexual reproduction; GO:0045861 negative regulation of proteolysis; GO:0046692 sperm competition
GO CC: GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence: MGWQGPKVDCTANGTQTECPVACPETCEYSGNGPCVKMCGAPCVCKPGYVINERIPACVLRSDCPKDVVRKEDMLLGVSNFKCFSRNYNCS
Length: 91(25-115)
Propeptide: MTDMWSLKICACLGLLLLFKPIDSMGWQGPKVDCTANGTQTECPVACPETCEYSGNGPCVKMCGAPCVCKPGYVINERIPACVLRSDCPKDVVRKEDMLLGVSNFKCFSRNYNCS
Signal peptide: MTDMWSLKICACLGLLLLFKPIDS
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Function: Responsible for physiological and behavioral changes in mated female flies. May contribute to the toxicity of seminal fluid and the decreased life-span of mated females. May also affect neuromuscular events after mating concerning sperm storage and egg re
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor006703_AF2.pdb

hor006703_ESM.pdb

Mass:	1148094	Formula:	C416H660N118O130S15
Absent amino acids:	H	Common amino acids:	C
pI:	7.43	Basic residues:	10
Polar residues:	38	Hydrophobic residues:	21
Hydrophobicity:	-23.96	Boman Index:	-13411
Half-Life:	30 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	>10 hour	Aliphatic Index	54.51
Instability Index:	4248.35	Extinction Coefficient cystines:	10720
Absorbance 280nm:	119.11

PubMed ID: 9474779
Title: New genes for male accessory gland proteins in Drosophila melanogaster.
PubMed ID: 14761057
Title: Population genetics of accessory gland proteins and sexual behavior in Drosophila melanogaster populations from Evolution Canyon.
PubMed ID: 10731132
Title: The genome sequence of Drosophila melanogaster.
PubMed ID: 12537572
Title: An
PubMed ID: 11102381
Title:
PubMed ID: 10612039
Title: