General Information

  • ID:  hor006703
  • Uniprot ID:  O46202
  • Protein name:  Accessory gland protein Acp62F
  • Gene name:  Acp62F
  • Organism:  Drosophila melanogaster (Fruit fly)
  • Family:  NA
  • Source:  Animal
  • Expression:  Produced in the male genital tract (at protein level) .
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   melanogaster subgroup , melanogaster group , Sophophora (subgenus), Drosophila (genus), Drosophilini (tribe), Drosophilinae (subfamily), Drosophilidae (family), Ephydroidea (superfamily), Acalyptratae , Schizophora , Cyclorrhapha , Eremoneura , Muscomorpha (infraorder), Brachycera (suborder), Diptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia , Insecta (class), Hexapoda (subphylum), Pancrustacea , Mandibulata , Arthropoda (phylum), Panarthropoda , Ecdysozoa , Protostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0004867 serine-type endopeptidase inhibitor activity
  • GO BP:  GO:0007610 behavior; GO:0019953 sexual reproduction; GO:0045861 negative regulation of proteolysis; GO:0046692 sperm competition
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  MGWQGPKVDCTANGTQTECPVACPETCEYSGNGPCVKMCGAPCVCKPGYVINERIPACVLRSDCPKDVVRKEDMLLGVSNFKCFSRNYNCS
  • Length:  91(25-115)
  • Propeptide:  MTDMWSLKICACLGLLLLFKPIDSMGWQGPKVDCTANGTQTECPVACPETCEYSGNGPCVKMCGAPCVCKPGYVINERIPACVLRSDCPKDVVRKEDMLLGVSNFKCFSRNYNCS
  • Signal peptide:  MTDMWSLKICACLGLLLLFKPIDS
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Responsible for physiological and behavioral changes in mated female flies. May contribute to the toxicity of seminal fluid and the decreased life-span of mated females. May also affect neuromuscular events after mating concerning sperm storage and egg re
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-O46202-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006703_AF2.pdbhor006703_ESM.pdb

Physical Information

Mass: 1148094 Formula: C416H660N118O130S15
Absent amino acids: H Common amino acids: C
pI: 7.43 Basic residues: 10
Polar residues: 38 Hydrophobic residues: 21
Hydrophobicity: -23.96 Boman Index: -13411
Half-Life / Aliphatic Index: 30 hour Aliphatic Index: 54.51
Instability Index: 4248.35 Extinction Coefficient cystines: 10720
Absorbance 280nm: 119.11

Literature

  • PubMed ID:  9474779
  • Title:  New genes for male accessory gland proteins in Drosophila melanogaster.
  • PubMed ID:  14761057
  • Title:  Population genetics of accessory gland proteins and sexual behavior in Drosophila melanogaster populations from Evolution Canyon.
  • PubMed ID:  10731132
  • Title:  The genome sequence of Drosophila melanogaster.
  • PubMed ID:  12537572
  • Title:  An
  • PubMed ID:  11102381
  • Title:  
  • PubMed ID:  10612039
  • Title: