HORDB

ID: hor006702
Uniprot ID: O09035
Protein name: Diazepam-binding inhibitor-like 5
Gene name: Dbil5
Organism: Mus musculus (Mouse)
Family: ACBP family
Source: animal
Expression: Expression is seen first at day 45 of post-natal development (post-meiotic transcription).|Exclusively expressed in late spermatids and spermatozoa. Not found in epididymis, spleen, bone marrow, skin, liver, brain, heart, kidney, muscle.
Disease: NA
Comments: NA
Taxonomy: Mus (subgenus), Mus (genus), Murinae (subfamily), Muridae (family), Muroidea , Myomorpha (suborder), Rodentia (order), Glires , Euarchontoglires (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
GO MF: GO:0000062 fatty-acyl-CoA binding; GO:0008289 lipid binding
GO BP: GO:0006631 fatty acid metabolic process
GO CC: GO:0005737 cytoplasm

Sequence: MSQVEFEMACASLKQLKGPVSDQEKLLVYSFYKQATQGDCNIPVPPATDVRAKAKYEAWMVNKGMSKMDAMRIYIAKVEELKKKEPC
Length: 87
Propeptide: MSQVEFEMACASLKQLKGPVSDQEKLLVYSFYKQATQGDCNIPVPPATDVRAKAKYEAWMVNKGMSKMDAMRIYIAKVEELKKKEPC
Signal peptide: NA
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

AF-O09035-F1.pdb

hor006702_AF2.pdb

hor006702_ESM.pdb

Mass:	1139877	Formula:	C436H703N113O128S9
Absent amino acids:	H	Common amino acids:	K
pI:	8.83	Basic residues:	14
Polar residues:	19	Hydrophobic residues:	27
Hydrophobicity:	-42.41	Boman Index:	-12969
Half-Life:	30 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	>10 hour	Aliphatic Index	69.54
Instability Index:	5898.28	Extinction Coefficient cystines:	11585
Absorbance 280nm:	134.71

PubMed ID: 8898349
Title: A novel endozepine-like peptide (ELP) is exclusively expressed in male germ cells.
PubMed ID: 10951202
Title: Structure and expression of the mouse gene encoding the endozepine-like peptide from haploid male germ cells.
PubMed ID: 15489334
Title: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
PubMed ID: 21183079
Title: A tissue-specific atlas of mouse protein phosphorylation and expression.