General Information

  • ID:  hor006701
  • Uniprot ID:  O01805
  • Protein name:  Acyl-CoA-binding protein homolog 1
  • Gene name:  acbp-1
  • Organism:  Caenorhabditis elegans
  • Family:  ACBP family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Caenorhabditis (genus), Peloderinae (subfamily), Rhabditidae (family), Rhabditoidea (superfamily), Rhabditomorpha (infraorder), Rhabditina (suborder), Rhabditida (order), Chromadorea (class), Nematoda (phylum), Ecdysozoa , Protostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0000062 fatty-acyl-CoA binding; GO:0008289 lipid binding; GO:0036042 long-chain fatty acyl-CoA binding
  • GO BP:  GO:0006631 fatty acid metabolic process; GO:0008340 determination of adult lifespan; GO:0019915 lipid storage
  • GO CC:  NA

Sequence Information

  • Sequence:  MTLSFDDAAATVKTLKTSPSNDELLKLYALFKQGTVGDNTTDKPGMFDLKGKAKWSAWDEKKGLAKDDAQKAYVALVEELIAKYGA
  • Length:  86
  • Propeptide:  MTLSFDDAAATVKTLKTSPSNDELLKLYALFKQGTVGDNTTDKPGMFDLKGKAKWSAWDEKKGLAKDDAQKAYVALVEELIAKYGA
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Binds medium- and long-chain acyl-CoA esters with very high affinity and may function as an intracellular carrier of acyl-CoA esters.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-O01805-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    AF-O01805-F1.pdbhor006701_AF2.pdbhor006701_ESM.pdb

Physical Information

Mass: 1089008 Formula: C422H669N105O131S2
Absent amino acids: CHR Common amino acids: KA
pI: 6.82 Basic residues: 13
Polar residues: 22 Hydrophobic residues: 32
Hydrophobicity: -42.44 Boman Index: -11830
Half-Life: 30 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 77.33
Instability Index: 1327.21 Extinction Coefficient cystines: 15470
Absorbance 280nm: 182

Literature

  • PubMed ID:  9851916
  • Title:  Genome sequence of the nematode C. elegans: a platform for investigating biology.