General Information

  • ID:  hor006699
  • Uniprot ID:  Q9V3J3
  • Protein name:  Accessory gland-specific peptide 57Dc
  • Gene name:  Mst57Dc
  • Organism:  Drosophila melanogaster (Fruit fly)
  • Family:  NA
  • Source:  Animal
  • Expression:  Accumulates after eclosion and gradually increases during sexual maturation. In males, levels decline immediately after mating and recover progressively. |Lumen fluid of male accessory glands, becomes seminal fluid.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   melanogaster subgroup , melanogaster group , Sophophora (subgenus), Drosophila (genus), Drosophilini (tribe), Drosophilinae (subfamily), Drosophilidae (family), Ephydroidea (superfamily), Acalyptratae , Schizophora , Cyclorrhapha , Eremoneura , Muscomorpha (infraorder), Brachycera (suborder), Diptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia , Insecta (class), Hexapoda (subphylum), Pancrustacea , Mandibulata , Arthropoda (phylum), Panarthropoda , Ecdysozoa , Protostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0003674 molecular_function
  • GO BP:  GO:0007610 behavior; GO:0018991 egg-laying behavior; GO:0019953 sexual reproduction; GO:0045924 regulation of female receptivity
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  SNGVTPDIKNVAKAERNMHNMLRCLKKNEPIVKSRILTLPPNCNQYVSAVVETWKPEGV
  • Length:  59(18-76)
  • Propeptide:  MHGTHFLILLLLCGVLGSNGVTPDIKNVAKAERNMHNMLRCLKKNEPIVKSRILTLPPNCNQYVSAVVETWKPEGV
  • Signal peptide:  MHGTHFLILLLLCGVLGSNG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Transferred from male to female during mating and may affect egglaying and behavior after mating.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q9V3J3-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006699_AF2.pdbhor006699_ESM.pdb

Physical Information

Mass: 766745 Formula: C289H479N85O85S4
Absent amino acids: F Common amino acids: NVK
pI: 9.93 Basic residues: 10
Polar residues: 18 Hydrophobic residues: 18
Hydrophobicity: -48.81 Boman Index: -10913
Half-Life / Aliphatic Index: 1.9 hour Aliphatic Index: 85.76
Instability Index: 3450.17 Extinction Coefficient cystines: 7115
Absorbance 280nm: 122.67

Literature

  • PubMed ID:  10451922
  • Title:  A 45-kDa cAMP-dependent phosphoprotein which is related to the product of Mst57Dc in Drosophila melanogaster.
  • PubMed ID:  7711745
  • Title:  Structure and regulation of a gene cluster for male accessory gland transcripts in Drosophila melanogaster.
  • PubMed ID:  15944345
  • Title:  Cross-species comparison of Drosoph
  • PubMed ID:  10731132
  • Title:  
  • PubMed ID:  12537572
  • Title: