HORDB

ID: hor006699
Uniprot ID: Q9V3J3
Protein name: Accessory gland-specific peptide 57Dc
Gene name: Mst57Dc
Organism: Drosophila melanogaster (Fruit fly)
Family: NA
Source: Animal
Expression: Accumulates after eclosion and gradually increases during sexual maturation. In males, levels decline immediately after mating and recover progressively. |Lumen fluid of male accessory glands, becomes seminal fluid.
Disease: NA
Comments: NA
Taxonomy: melanogaster subgroup , melanogaster group , Sophophora (subgenus), Drosophila (genus), Drosophilini (tribe), Drosophilinae (subfamily), Drosophilidae (family), Ephydroidea (superfamily), Acalyptratae , Schizophora , Cyclorrhapha , Eremoneura , Muscomorpha (infraorder), Brachycera (suborder), Diptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia , Insecta (class), Hexapoda (subphylum), Pancrustacea , Mandibulata , Arthropoda (phylum), Panarthropoda , Ecdysozoa , Protostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
GO MF: GO:0003674 molecular_function
GO BP: GO:0007610 behavior; GO:0018991 egg-laying behavior; GO:0019953 sexual reproduction; GO:0045924 regulation of female receptivity
GO CC: GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence: SNGVTPDIKNVAKAERNMHNMLRCLKKNEPIVKSRILTLPPNCNQYVSAVVETWKPEGV
Length: 59(18-76)
Propeptide: MHGTHFLILLLLCGVLGSNGVTPDIKNVAKAERNMHNMLRCLKKNEPIVKSRILTLPPNCNQYVSAVVETWKPEGV
Signal peptide: MHGTHFLILLLLCGVLGSNG
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Function: Transferred from male to female during mating and may affect egglaying and behavior after mating.
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor006699_AF2.pdb

hor006699_ESM.pdb

Mass:	766745	Formula:	C289H479N85O85S4
Absent amino acids:	F	Common amino acids:	NVK
pI:	9.93	Basic residues:	10
Polar residues:	18	Hydrophobic residues:	18
Hydrophobicity:	-48.81	Boman Index:	-10913
Half-Life:	1.9 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	>10 hour	Aliphatic Index	85.76
Instability Index:	3450.17	Extinction Coefficient cystines:	7115
Absorbance 280nm:	122.67

PubMed ID: 10451922
Title: A 45-kDa cAMP-dependent phosphoprotein which is related to the product of Mst57Dc in Drosophila melanogaster.
PubMed ID: 7711745
Title: Structure and regulation of a gene cluster for male accessory gland transcripts in Drosophila melanogaster.
PubMed ID: 15944345
Title: Cross-species comparison of Drosoph
PubMed ID: 10731132
Title:
PubMed ID: 12537572
Title: