General Information

  • ID:  hor006698
  • Uniprot ID:  Q9PW66
  • Protein name:  Prokineticin Bv8
  • Gene name:  NA
  • Organism:  Bombina variegata (Yellow-bellied toad)
  • Family:  AVIT (prokineticin) family
  • Source:  Animal
  • Expression:  Expressed by the skin glands.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Bombina (genus), Bombinatoridae (family), Anura (order), Batrachia (superorder), Amphibia (class), Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0090729 toxin activity
  • GO BP:  GO:0035821 modulation of process of another organism
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  AVITGACDKDVQCGSGTCCAASAWSRNIRFCIPLGNSGEDCHPASHKVPYDGKRLSSLCPCKSGLTCSKSGEKFKCS
  • Length:  77(20-96)
  • Propeptide:  MKCFAQIVVLLLVIAFSHGAVITGACDKDVQCGSGTCCAASAWSRNIRFCIPLGNSGEDCHPASHKVPYDGKRLSSLCPCKSGLTCSKSGEKFKCS
  • Signal peptide:  MKCFAQIVVLLLVIAFSHG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  1-5Missing: Does not activate prokineticin receptor 2.

Activity

  • Function:  Potent agonist for both PKR1/PROKR1 and PKR2/PROKR2, and inducer of a potent and long-lasting hyperalgesia (PubMed:16299550, PubMed:20677202). Shows an EC(50) of 0.264 nM, when tested on neuroblastoma cells (SH-SY5Y) which endogenously express mainly PKR2
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  7-19; 13-31; 18-59; 41-67; 61-76
  • Structure ID:  AF-Q9PW66-F1(AlphaFold_DB_ID)/2KRA(PDB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    2kra.pdbhor006698_AF2.pdbhor006698_ESM.pdb

Physical Information

Mass: 938598 Formula: C335H539N101O108S10
Absent amino acids: M Common amino acids: SC
pI: 8.27 Basic residues: 12
Polar residues: 35 Hydrophobic residues: 19
Hydrophobicity: -24.29 Boman Index: -11947
Half-Life: 4.4 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 54.55
Instability Index: 4056.1 Extinction Coefficient cystines: 7615
Absorbance 280nm: 100.2

Literature

  • PubMed ID:  10422759
  • Title:  Bv8, a small protein from frog skin and its homologue from snake venom induce hyperalgesia in rats.
  • PubMed ID:  12466223
  • Title:  Nociceptive sensitization by the secretory protein Bv8.
  • PubMed ID:  16299550
  • Title:  Bv8, the amphibian homologue of the mammalian prokineticins, induces a proinflammatory phenotype
  • PubMed ID:  16687502
  • Title:  
  • PubMed ID:  20677202
  • Title: