General Information

  • ID:  hor006696
  • Uniprot ID:  Q9PU29
  • Protein name:  Cholecystokinin-70
  • Gene name:  CCK
  • Organism:  Struthio camelus (Common ostrich)
  • Family:  Gastrin/cholecystokinin family
  • Source:  Animal
  • Expression:  Highly concentrated in the duodenum. Also localized in more distal parts of the small intestine.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Struthio (genus), Struthionidae (family), Struthioniformes (order), Palaeognathae (superorder), Aves (class), Coelurosauria, Theropoda, Saurischia, Dinosauria, Archosauria, Archelosauria, Sauria, Sauropsida, Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0001764 neuron migration; GO:0007165 signal transduction; GO:0007409 axonogenesis; GO:0007586 digestion
  • GO CC:  GO:0005576 extracellular region; GO:0030424 axon

Sequence Information

  • Sequence:  APSSAGPLKPVPRLDGSIDQRANIGALLAKYLQQARKGPTGRISVMGNRVQSIDPTHRINDRDYMGWMDF
  • Length:  70(49-118)
  • Propeptide:  MYSGICICVFLAVLSASSFGQQTAGSHNGNPLAAELEQSLTEHHRHVRAPSSAGPLKPVPRLDGSIDQRANIGALLAKYLQQARKGPTGRISVMGNRVQSIDPTHRINDRDYMGWMDFGRRSAEEYEYSS
  • Signal peptide:  MYSGICICVFLAVLSASSFG
  • Modification:  T64 Sulfotyrosine;T70 Phenylalanine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut. Its function in the brain is not clear (By similarity).
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q9PU29-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor006696_AF2.pdbhor006696_ESM.pdb

Physical Information

Mass: 893775 Formula: C335H542N104O99S3
Absent amino acids: CE Common amino acids: GRADP
pI: 10.69 Basic residues: 11
Polar residues: 19 Hydrophobic residues: 21
Hydrophobicity: -56.86 Boman Index: -15145
Half-Life: 4.4 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 76.71
Instability Index: 4462.71 Extinction Coefficient cystines: 8480
Absorbance 280nm: 122.9

Literature

  • PubMed ID:  11072120
  • Title:  Identification of ostrich and chicken cholecystokinin cDNA and intestinal peptides.