General Information

  • ID:  hor006683
  • Uniprot ID:  Q91330
  • Protein name:  Progonadoliberin-2
  • Gene name:  gnrh2
  • Organism:  Rutilus rutilus (Roach)
  • Family:  GnRH family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Rutilus (genus), Leuciscinae (subfamily), Leuciscidae (family), Cyprinoidei (suborder), Cypriniformes (order), Cypriniphysae (superorder), Otophysi, Ostariophysi (subcohort), Otomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  QHWSHGWYPGGKREIDIYDTSEVSGEIKLCEAGKCSYLRPQGRNILKTILLDALIRDFQKRK
  • Length:  62(25-86)
  • Propeptide:  MVHICRLLVLMGMLLCLSAQFASSQHWSHGWYPGGKREIDIYDTSEVSGEIKLCEAGKCSYLRPQGRNILKTILLDALIRDFQKRK
  • Signal peptide:  MVHICRLLVLMGMLLCLSAQFASS
  • Modification:  T1 Pyrrolidone carboxylic acid;T10 Glycine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Stimulates the secretion of gonadotropins.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q91330-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006683_AF2.pdbhor006683_ESM.pdb

Physical Information

Mass: 830752 Formula: C322H509N93O92S2
Absent amino acids: M Common amino acids: GIKLR
pI: 9.23 Basic residues: 13
Polar residues: 18 Hydrophobic residues: 18
Hydrophobicity: -72.26 Boman Index: -13922
Half-Life: 0.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 83.39
Instability Index: 5023.39 Extinction Coefficient cystines: 15595
Absorbance 280nm: 255.66

Literature

  • PubMed ID:  9460654
  • Title:  Isolation and characterisation of mRNA encoding the salmon- and chicken-II type gonadotrophin-releasing hormones in the teleost fish Rutilus rutilus (Cyprinidae).