General Information

  • ID:  hor006681
  • Uniprot ID:  Q8UW81
  • Protein name:  Progonadoliberin-2
  • Gene name:  gnrh2
  • Organism:  Verasper moseri (Barfin flounder)
  • Family:  GnRH family
  • Source:  Animal
  • Expression:  Midbrain tegmentum.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Verasper (genus), Pleuronectidae (family), Pleuronectoidei (suborder), Pleuronectiformes (order), Carangaria, Percomorphaceae, Euacanthomorphacea, Acanthomorphata, Ctenosquamata, Eurypterygia, Neoteleostei, Euteleosteomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005183 gonadotropin hormone-releasing hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  QHWSHGWYPGGKRELDSFGTSEISEEIKLCEAGECSYLRPQRRNILRNILLDALARELQKRK
  • Length:  62(24-85)
  • Propeptide:  MCASRLVLLLGLLLCVGAHLSSGQHWSHGWYPGGKRELDSFGTSEISEEIKLCEAGECSYLRPQRRNILRNILLDALARELQKRK
  • Signal peptide:  MCASRLVLLLGLLLCVGAHLSSG
  • Modification:  T1 Pyrrolidone carboxylic acid;T10 Glycine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Stimulates the secretion of gonadotropins.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q8UW81-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006681_AF2.pdbhor006681_ESM.pdb

Physical Information

Mass: 837249 Formula: C319H508N98O94S2
Absent amino acids: MV Common amino acids: LER
pI: 8.76 Basic residues: 13
Polar residues: 17 Hydrophobic residues: 18
Hydrophobicity: -89.03 Boman Index: -17145
Half-Life / Aliphatic Index: 0.8 hour Aliphatic Index: 80.32
Instability Index: 9666.29 Extinction Coefficient cystines: 14105
Absorbance 280nm: 231.23

Literature

  • PubMed ID:  12093120
  • Title:  Molecular cloning of three cDNAs encoding different GnRHs in the brain of barfin flounder.