General Information

  • ID:  hor006678
  • Uniprot ID:  Q8R413
  • Protein name:  Prokineticin-2
  • Gene name:  Prok2
  • Organism:  Rattus norvegicus (Rat)
  • Family:  AVIT (prokineticin) family
  • Source:  animal
  • Expression:  Activated by CLOCK and BMAL1 heterodimers and light; inhibited by period genes (PER1, PER2 and PER3) and cryptochrome genes (CRY1 and CRY2). |Expressed at high levels in testis and at lower levels in brain, lung, ovary, spleen, thymus and uterus.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Rattus (genus), Murinae (subfamily), Muridae (family), Muroidea , Myomorpha (suborder), Rodentia (order), Glires , Euarchontoglires (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0001664 G protein-coupled receptor binding
  • GO BP:  GO:0001525 angiogenesis; GO:0001935 endothelial cell proliferation; GO:0006935 chemotaxis; GO:0007218 neuropeptide signaling pathway; GO:0007283 spermatogenesis; GO:0007623 circadian rhythm; GO:0043066 negative regulation of apoptotic process; GO:0045987 positive regulation of smooth muscle contraction; GO:0048511 rhythmic process
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  AVITGACDKDSQCGGGMCCAVSIWVKSIRICTPMGQVGDSCHPLTRKVPFWGRRMHHTCPCLPGLACLRTSFNRFICLARK
  • Length:  81
  • Propeptide:  MEDPRCAPLLLLLLLPLLLTPPAGDAAVITGACDKDSQCGGGMCCAVSIWVKSIRICTPMGQVGDSCHPLTRKVPFWGRRMHHTCPCLPGLACLRTSFNRFICLARK
  • Signal peptide:  MEDPRCAPLLLLLLLPLLLTPPAGDA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  May function as an output molecule from the suprachiasmatic nucleus (SCN) that transmits behavioral circadian rhythm. May also function locally within the SCN to synchronize output. Potently contracts gastrointestinal (GI) smooth muscle (By similarity).
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  Prokr2, Prokr1
  • Target Unid:  Q8R415, Q8R416
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  7-19; 13-31; 18-59; 41-67; 61-77
  • Structure ID:  AF-Q8R413-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor006678_AF2.pdbhor006678_ESM.pdb

Physical Information

Mass: 1028274 Formula: C380H615N117O101S13
Absent amino acids: EY Common amino acids: C
pI: 8.93 Basic residues: 14
Polar residues: 29 Hydrophobic residues: 25
Hydrophobicity: 15.31 Boman Index: -9493
Half-Life: 4.4 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 72.22
Instability Index: 6558.89 Extinction Coefficient cystines: 11625
Absorbance 280nm: 145.31

Literature

  • PubMed ID:  12054613
  • Title:  Isolation and identification of EG-VEGF/prokineticins as cognate ligands for two orphan G-protein-coupled receptors.
  • PubMed ID:  12024206
  • Title:  Prokineticin 2 transmits the behavioural circadian rhythm of the suprachiasmatic nucleus.