General Information

  • ID:  hor006675
  • Uniprot ID:  Q8JFY0
  • Protein name:  Prokineticin Bm8-d
  • Gene name:  NA
  • Organism:  Bombina maxima (Giant fire-bellied toad) (Chinese red belly toad)
  • Family:  AVIT (prokineticin) family
  • Source:  animal
  • Expression:  Expressed by the skin glands.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Bombina (genus), Bombinatoridae (family), Anura (order), Batrachia (superorder), Amphibia (class), Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0090729 toxin activity
  • GO BP:  GO:0035821 modulation of process of another organism
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  AVITGVCDRDAQCGSGTCCAASAFSRNIRFCVPLGNNGEECHPASHKVPYNGKRLSSLCPCNTGLTCSKSGEKSQCS
  • Length:  77
  • Propeptide:  MKCFAQIVVLLLVIAFSHGAVITGVCDRDAQCGSGTCCAASAFSRNIRFCVPLGNNGEECHPASHKVPYNGKRLSSLCPCNTGLTCSKSGEKSQCS
  • Signal peptide:  MKCFAQIVVLLLVIAFSHG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Potent agonist for both PKR1/PROKR1 and PKR2/PROKR2, and inducer of a potent and long-lasting hyperalgesia. Also potentiates capsaicin-induced TRPV1 current, when tested on DRG neurons. At subnanomolar concentrations, this protein both induces potent chemotaxis of macrophages and stimulates LPS-induced production of the pro-inflammatory cytokines IL-1 and IL-12. In vivo, potently stimulates the contraction of the guinea-pig gastrointestinal (GI) smooth muscle (nanomolar concentration).
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  7-19; 13-31; 18-59; 41-67; 61-76
  • Structure ID:  AF-Q8JFY0-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006675_AF2.pdbhor006675_ESM.pdb

Physical Information

Mass: 934080 Formula: C326H528N104O110S10
Absent amino acids: MW Common amino acids: CS
pI: 8.09 Basic residues: 10
Polar residues: 38 Hydrophobic residues: 18
Hydrophobicity: -27.66 Boman Index: -13495
Half-Life: 4.4 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 53.25
Instability Index: 3982.21 Extinction Coefficient cystines: 2115
Absorbance 280nm: 27.83

Literature

  • PubMed ID:  12413397
  • Title:  Granular gland transcriptomes in stimulated amphibian skin secretions.