General Information

  • ID:  hor006666
  • Uniprot ID:  Q2XXR8
  • Protein name:  AVIToxin-VAR1
  • Gene name:  NA
  • Organism:  Varanus varius (Lace monitor lizard) (Lacerta varia)
  • Family:  AVIT (prokineticin) family
  • Source:  Animal
  • Expression:  Expressed by the venom gland.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Varanus (genus), Varanidae (family), Varanoidea (superfamily), Paleoanguimorpha , Anguimorpha (infraorder), Toxicofera , Episquamata , Unidentata , Bifurcata , Squamata (order), Lepidosauria (class), Sauria , Sauropsida , Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0090729 toxin activity
  • GO BP:  GO:0035821 modulation of process of another organism
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  AVITGACDKDLQCGEGMCCAVSLWIRSIRICTPLGSSGEDCHPLSHKVPFDGQRKHHTCPCLPNLVCGQTSPGKYKCLPEFKNVF
  • Length:  85(20-104)
  • Propeptide:  MRSLLCAPLLLLLLSAGESAVITGACDKDLQCGEGMCCAVSLWIRSIRICTPLGSSGEDCHPLSHKVPFDGQRKHHTCPCLPNLVCGQTSPGKYKCLPEFKNVF
  • Signal peptide:  MRSLLCAPLLLLLLSAGES
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Potent agonist for both PKR1/PROKR1 and PKR2/PROKR2. Potently contracts gastrointestinal (GI) smooth muscle.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  7-19; 13-31; 18-59; 41-67; 61-77
  • Structure ID:  AF-Q2XXR8-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006666_AF2.pdbhor006666_ESM.pdb

Physical Information

Mass: 1073328 Formula: C399H632N114O116S11
Absent amino acids: Common amino acids: C
pI: 7.89 Basic residues: 13
Polar residues: 31 Hydrophobic residues: 23
Hydrophobicity: -11.29 Boman Index: -9904
Half-Life / Aliphatic Index: 4.4 hour Aliphatic Index: 71.06
Instability Index: 5708.71 Extinction Coefficient cystines: 7615
Absorbance 280nm: 90.65

Literature

  • PubMed ID:  16292255
  • Title:  Early evolution of the venom system in lizards and snakes.