HORDB

ID: hor006664
Uniprot ID: Q28469
Protein name: Endothelin-1
Gene name: EDN1
Organism: Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Family: Endothelin/sarafotoxin family
Source: Animal
Expression: NA
Disease: NA
Comments: NA
Taxonomy: Macaca (genus), Cercopithecinae (subfamily), Cercopithecidae (family), Cercopithecoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
GO MF: NA
GO BP: GO:0019229 regulation of vasoconstriction; GO:0042310 vasoconstriction; GO:0086100 endothelin receptor signaling pathway; GO:0097746 blood vessel diameter maintenance; GO:1900182 positive regulation of protein localization to nucleus
GO CC: GO:0005576 extracellular region

Sequence: VVPYGLGSPRSKRALENLLPTKATDRENRCQCASQKDKKCWNFCQAGKELRAKDLMEKGWNNHKKGKDCSKLGKKC
Length: 76(1-76)
Propeptide: VVPYGLGSPRSKRALENLLPTKATDRENRCQCASQKDKKCWNFCQAGKELRAKDLMEKGWNNHKKGKDCSKLGKKC
Signal peptide: NA
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Function: Endothelins are endothelium-derived vasoconstrictor peptides (By similarity). Probable ligand for G-protein coupled receptors EDNRA and EDNRB which activates PTK2B, BCAR1, BCAR3 and, GTPases RAP1 and RHOA cascade in glomerular mesangial cells (By similari
Mechanism: NA
Cross BBB: NA
Target: EDNRA
Target Unid: G7P6D6
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

AF-Q28469-F1.pdb

hor006664_AF2.pdb

hor006664_ESM.pdb

Mass:	996299	Formula:	C368H609N117O108S7
Absent amino acids:	I	Common amino acids:	K
pI:	10.32	Basic residues:	20
Polar residues:	24	Hydrophobic residues:	17
Hydrophobicity:	-115.13	Boman Index:	-21290
Half-Life:	100 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	>10 hour	Aliphatic Index	50.13
Instability Index:	3108.55	Extinction Coefficient cystines:	12865
Absorbance 280nm:	171.53

PubMed ID: 8964809
Title: Increased expression of endothelin B receptor mRNA following subarachnoid hemorrhage in monkeys.