General Information

  • ID:  hor006659
  • Uniprot ID:  Q26324
  • Protein name:  RPCH-related peptide
  • Gene name:  NA
  • Organism:  Carcinus maenas (Common shore crab) (Green crab)
  • Family:  AKH/HRTH/RPCH family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Carcinus (genus), Carcinidae (family), Portunoidea (superfamily), Heterotremata , Eubrachyura , Brachyura (infraorder), Pleocyemata (suborder), Decapoda (order), Eucarida (superorder), Eumalacostraca (subclass), Malacostraca (class), Multicrustacea (superclass), Crustacea (subphylum), Pancrustacea , Mandibulata , Arthropoda (phylum), Panarthropoda , Ecdysozoa , Protostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0031409 pigment binding
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  AAAGSGSSGGVGEAVSALHHSVGGAPGGVVPPGSSSSSGDSCGPIPVSAVMHIYRLIRNEAVRLVQCQDEEYLG
  • Length:  74(37-110)
  • Propeptide:  MVRRTGVTLLVVALVVVALVSSVSAQLNFSPGWGKRAAAGSGSSGGVGEAVSALHHSVGGAPGGVVPPGSSSSSGDSCGPIPVSAVMHIYRLIRNEAVRLVQCQDEEYLG
  • Signal peptide:  MVRRTGVTLLVVALVVVALVSSVSA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  This hormone adapts the animal to light backgrounds by stimulating concentration of the pigment of its red body-chromatophores.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q26324-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006659_AF2.pdbhor006659_ESM.pdb

Physical Information

Mass: 850624 Formula: C305H488N92O104S3
Absent amino acids: FKTW Common amino acids: GS
pI: 5.44 Basic residues: 6
Polar residues: 30 Hydrophobic residues: 24
Hydrophobicity: 10.54 Boman Index: -5981
Half-Life / Aliphatic Index: 4.4 hour Aliphatic Index: 82.97
Instability Index: 5848.11 Extinction Coefficient cystines: 3105
Absorbance 280nm: 42.53

Literature

  • PubMed ID:  8373416
  • Title:  Molecular cloning of crustacean red pigment concentrating hormone precursor.