General Information

  • ID:  hor006654
  • Uniprot ID:  Q18234
  • Protein name:  Fmrf-like peptide protein 21
  • Gene name:  flp-21
  • Organism:  Caenorhabditis elegans
  • Family:  FARP (FMRFamide related peptide) family
  • Source:  Animal
  • Expression:  Expressed in the ADL, ASE and ASH sensory neurons, the URA motor neurons and the MC, M2 and M4 pharyngeal neurons.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Caenorhabditis (genus), Peloderinae (subfamily), Rhabditidae (family), Rhabditoidea (superfamily), Rhabditomorpha (infraorder), Rhabditina (suborder), Rhabditida (order), Chromadorea (class), Nematoda (phylum), Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0031841 neuropeptide Y receptor binding
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0007631 feeding behavior; GO:0030431 sleep
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  MRLFILLSCLLAWVLAAPYIDQEDALRVLNAYLEQFGPGSDRVYYVAEDDHGSMKRGLGPRPLRFG
  • Length:  66(1-66)
  • Propeptide:  MRLFILLSCLLAWVLAAPYIDQEDALRVLNAYLEQFGPGSDRVYYVAEDDHGSMKRGLGPRPLRFG
  • Signal peptide:  MRLFILLSCLLAWVLA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  FMRFamide-like neuropeptide (PubMed:12821653, PubMed:14555955). Involved in modulating locomotion quiescence during the sleep-like state called lethargus which occurs during molting between larval and adult stages, acting via the G-protein coupled recepto
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  npr-5
  • Target Unid:  Q6F3C9
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q18234-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    AF-Q18234-F1.pdbhor006654_AF2.pdbhor006654_ESM.pdb

Physical Information

Mass: 864528 Formula: C341H527N91O93S3
Absent amino acids: T Common amino acids: L
pI: 5.73 Basic residues: 8
Polar residues: 15 Hydrophobic residues: 27
Hydrophobicity: 4.85 Boman Index: -7837
Half-Life: 30 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 103.48
Instability Index: 4092.27 Extinction Coefficient cystines: 11460
Absorbance 280nm: 176.31

Literature

  • PubMed ID:  9851916
  • Title:  Genome sequence of the nematode C. elegans: a platform for investigating biology.
  • PubMed ID:  12821653
  • Title:  Differential activation of "social" and "solitary" variants of the Caenorhabditis elegans G protein-coupled receptor NPR-1 by its cognate ligand AF9.
  • PubMed ID:  14555955
  • Title:  Inhibition of Caenorh
  • PubMed ID:  23764289
  • Title:  
  • PubMed ID:  25804345
  • Title:  
  • PubMed ID:  30229400
  • Title: