HORDB

ID: hor006653
Uniprot ID: P84118
Protein name: Bursicon
Gene name: burs
Organism: Periplaneta americana (American cockroach) (Blatta americana)
Family: NA
Source: Animal
Expression: Central nervous system. Coexpressed with CCAP in most CCAP-specific neurons. Coexpressed with pburs in the large bilateral lateral neurosecretory neurons of the first three unfused abdominal ganglia and in all anterior bilateral cell pairs in the thoracic
Disease: NA
Comments: NA
Taxonomy: Periplaneta (genus), Blattinae (subfamily), Blattidae (family), Blattoidea (superfamily), Blattodea (order), Dictyoptera (superorder), Polyneoptera (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia , Insecta (class), Hexapoda (subphylum), Pancrustacea , Mandibulata , Arthropoda (phylum), Panarthropoda , Ecdysozoa , Protostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
GO MF: GO:0005179 hormone activity; GO:0005507 copper ion binding; GO:0046872 metal ion binding
GO BP: GO:0006801 superoxide metabolic process; GO:0007165 signal transduction; GO:0007593 chitin-based cuticle sclerotization; GO:0048067 cuticle pigmentation
GO CC: GO:0005576 extracellular region

Sequence: GTVFFDQDSPDSPVKVTGEVTGLQKHGFHIHEFGDNTNMSADGSSYLQVSGSKLTQEGQASMEVKGNAGARVAXGVVGIAK
Length: 81(1-81)
Propeptide: GTVFFDQDSPDSPVKVTGEVTGLQKHGFHIHEFGDNTNMSADGSSYLQVSGSKLTQEGQASMEVKGNAGARVAXGVVGIAK
Signal peptide: NA
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Function: Final heterodimeric neurohormone released at the end of the molting cycle, involved in the sclerotization (tanning) of the insect cuticle, melanization and wing spreading.
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor006653_AF2.pdb

hor006653_ESM.pdb

Mass:	980023	Formula:	C357H558N102O120S2
Absent amino acids:	CW	Common amino acids:	G
pI:	5.51	Basic residues:	9
Polar residues:	29	Hydrophobic residues:	24
Hydrophobicity:	-34.94	Boman Index:	-11558
Half-Life:	30 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	>10 hour	Aliphatic Index	63.7
Instability Index:	3444.69	Extinction Coefficient cystines:	1490
Absorbance 280nm:	18.63

PubMed ID: 10528407
Title: Antisera against Periplaneta americana Cu,Zn-superoxide dismutase (SOD): separation of the neurohormone bursicon from SOD, and immunodetection of SOD in the central nervous system.
PubMed ID: 12271490
Title: Cellular localization of bursicon using antisera against partial peptide
PubMed ID: 15703293
Title: