General Information

  • ID:  hor006640
  • Uniprot ID:  P51924
  • Protein name:  Progonadoliberin IIA
  • Gene name:  gnrh2a
  • Organism:  Carassius auratus (Goldfish)
  • Family:  GnRH family
  • Source:  Animal
  • Expression:  Olfactory bulbs, hypothalamus and telencephalon, midbrain and posterior brain areas.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Carassius (genus), Cyprininae (subfamily), Cyprinidae (family), Cyprinoidei (suborder), Cypriniformes (order), Cypriniphysae (superorder), Otophysi, Ostariophysi (subcohort), Otomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  QHWSHGWYPGGKREIDVYDSSEVSGEIKLCEAGKCSYLRPQGRNILKTILLDAIIRDSQKRK
  • Length:  62(25-86)
  • Propeptide:  MVHICRLFVVMGMLLCLSAQFASSQHWSHGWYPGGKREIDVYDSSEVSGEIKLCEAGKCSYLRPQGRNILKTILLDAIIRDSQKRK
  • Signal peptide:  MVHICRLFVVMGMLLCLSAQFASS
  • Modification:  T1 Pyrrolidone carboxylic acid;T10 Glycine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Stimulates the secretion of gonadotropins.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P51924-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006640_AF2.pdbhor006640_ESM.pdb

Physical Information

Mass: 821936 Formula: C314H501N93O93S2
Absent amino acids: FM Common amino acids: GIKSLR
pI: 9.23 Basic residues: 13
Polar residues: 19 Hydrophobic residues: 17
Hydrophobicity: -77.58 Boman Index: -14731
Half-Life: 0.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 81.77
Instability Index: 6508.39 Extinction Coefficient cystines: 15595
Absorbance 280nm: 255.66

Literature

  • PubMed ID:  8729938
  • Title:  Expression of salmon gonadotropin-releasing hormone (GnRH) and chicken GnRH-II precursor messenger ribonucleic acids in the brain and ovary of goldfish.
  • PubMed ID:  9289408
  • Title:  Cloning and expression pattern of a second [His5Trp7Tyr8]gonadotropin-releasing hormone (chicken GnRH