General Information

  • ID:  hor006639
  • Uniprot ID:  P51919
  • Protein name:  Progonadoliberin-1
  • Gene name:  gnrh1
  • Organism:  Sparus aurata (Gilthead sea bream)
  • Family:  GnRH family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Sparus (genus), Sparidae (family), Spariformes (order), Eupercaria, Percomorphaceae, Euacanthomorphacea, Acanthomorphata, Ctenosquamata, Eurypterygia, Neoteleostei, Euteleosteomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  QHWSYGLSPGGKRDLDSLSDTLGNIIERFPHVDSPCSVLGCVEEPHVPRMYRMKGFIGSERDIGHRMYKK
  • Length:  70(26-95)
  • Propeptide:  MAPQTSNLWILLLLVVVMMMSQGCCQHWSYGLSPGGKRDLDSLSDTLGNIIERFPHVDSPCSVLGCVEEPHVPRMYRMKGFIGSERDIGHRMYKK
  • Signal peptide:  MAPQTSNLWILLLLVVVMMMSQGCC
  • Modification:  T1 Pyrrolidone carboxylic acid;T10 Glycine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Stimulates the secretion of gonadotropins.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P51919-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006639_AF2.pdbhor006639_ESM.pdb

Physical Information

Mass: 921901 Formula: C350H545N103O102S5
Absent amino acids: A Common amino acids: GS
pI: 8.24 Basic residues: 14
Polar residues: 22 Hydrophobic residues: 16
Hydrophobicity: -65.86 Boman Index: -15431
Half-Life / Aliphatic Index: 0.8 hour Aliphatic Index: 66.71
Instability Index: 5411.29 Extinction Coefficient cystines: 10095
Absorbance 280nm: 146.3

Literature

  • PubMed ID:  7749463
  • Title:  Molecular cloning and characterization of a novel gonadotropin-releasing hormone from the gilthead seabream (Sparus aurata).
  • PubMed ID:  7991588
  • Title:  Three forms of gonadotropin-releasing hormone characterized from brains of one species.