General Information

  • ID:  hor006635
  • Uniprot ID:  P51917
  • Protein name:  GnRH-associated peptide 3
  • Gene name:  gnrh3
  • Organism:  Carassius auratus (Goldfish)
  • Family:  GnRH family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Carassius (genus), Cyprininae (subfamily), Cyprinidae (family), Cyprinoidei (suborder), Cypriniformes (order), Cypriniphysae (superorder), Otophysi, Ostariophysi (subcohort), Otomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  SVGEVEATFRMMDSGDAVLSIPMDSPMERLSPIHIVSEVDAEGLPLKEQRFPNRRGRD
  • Length:  58(37-94)
  • Propeptide:  MEGKGRVLVQLLMLACVLEVSLCQHWSYGWLPGGKRSVGEVEATFRMMDSGDAVLSIPMDSPMERLSPIHIVSEVDAEGLPLKEQRFPNRRGRD
  • Signal peptide:  MEGKGRVLVQLLMLACVLEVSLC
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Stimulates the secretion of gonadotropins.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P51917-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006635_AF2.pdbhor006635_ESM.pdb

Physical Information

Mass: 748719 Formula: C276H449N81O90S4
Absent amino acids: CWY Common amino acids: ERSDPV
pI: 4.46 Basic residues: 8
Polar residues: 12 Hydrophobic residues: 17
Hydrophobicity: -45.52 Boman Index: -14015
Half-Life / Aliphatic Index: 1.9 hour Aliphatic Index: 77.24
Instability Index: 5327.07 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  8729938
  • Title:  Expression of salmon gonadotropin-releasing hormone (GnRH) and chicken GnRH-II precursor messenger ribonucleic acids in the brain and ovary of goldfish.