General Information

  • ID:  hor006629
  • Uniprot ID:  P33739
  • Protein name:  Accessory gland-specific peptide 26Ab
  • Gene name:  Acp26Ab
  • Organism:  Drosophila sechellia (Fruit fly)
  • Family:  NA
  • Source:  Animal
  • Expression:  Main cells of the accessory glands of males.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   melanogaster subgroup , melanogaster group , Sophophora (subgenus), Drosophila (genus), Drosophilini (tribe), Drosophilinae (subfamily), Drosophilidae (family), Ephydroidea (superfamily), Acalyptratae , Schizophora , Cyclorrhapha , Eremoneura , Muscomorpha (infraorder), Brachycera (suborder), Diptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia , Insecta (class), Hexapoda (subphylum), Pancrustacea , Mandibulata , Arthropoda (phylum), Panarthropoda , Ecdysozoa , Protostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007610 behavior; GO:0007617 mating behavior; GO:0019953 sexual reproduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  APFISVQSSSQSRSQKVMNGMLRTLYDYSVQDSVNDATGHLIHTHKSNFNSDVMSPEEIERVRQQLNMA
  • Length:  69(22-90)
  • Propeptide:  MNYFAVLCIFSCICLWQFSDAAPFISVQSSSQSRSQKVMNGMLRTLYDYSVQDSVNDATGHLIHTHKSNFNSDVMSPEEIERVRQQLNMA
  • Signal peptide:  MNYFAVLCIFSCICLWQFSDA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  This protein is transferred from male to female during mating and may affect egglaying and behavior after mating.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P33739-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006629_AF2.pdbhor006629_ESM.pdb

Physical Information

Mass: 902574 Formula: C331H528N100O111S4
Absent amino acids: CW Common amino acids: S
pI: 6.8 Basic residues: 9
Polar residues: 23 Hydrophobic residues: 18
Hydrophobicity: -62.9 Boman Index: -17055
Half-Life: 4.4 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 69.13
Instability Index: 9399.42 Extinction Coefficient cystines: 2980
Absorbance 280nm: 43.82

Literature

  • PubMed ID:  1361475
  • Title:  Polymorphism and divergence in the Mst26A male accessory gland gene region in Drosophila.
  • PubMed ID:  15238524
  • Title:  Molecular population genetics of male accessory gland proteins in the Drosophila simulans complex.
  • PubMed ID:  17994087
  • Title:  Evolution of genes and genomes on the Drosophila phylogeny.