General Information

  • ID:  hor006617
  • Uniprot ID:  P05060
  • Protein name:  CCB peptide
  • Gene name:  CHGB
  • Organism:  Homo sapiens (Human)
  • Family:  Chromogranin/secretogranin protein family
  • Source:  Human
  • Expression:  Expressed in the adrenal medulla, and in pheochromocytoma. Not expressed in liver.
  • Disease:  Diseases associated with CHGB include Pheochromocytoma and Neuroendocrine Tumor.
  • Comments:  NA
  • Taxonomy:  Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005515 protein binding
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0005788 endoplasmic reticulum lumen; GO:0030141 secretory granule

Sequence Information

  • Sequence:  SAEFPDFYDSEEPVSTHQEAENEKDRADQTVLTEDEKKELENLAAMDLELQKIAEKFSQR
  • Length:  60(617-676)
  • Propeptide:  MQPTLLLSLLGAVGLAAVNSMPVDNRNHNEGMVTRCIIEVLSNALSKSSAPPITPECRQVLKTSRKDVKDKETTENENTKFEVRLLRDPADASEAHESSSRGEAGAPGEEDIQGPTKADTEKWAEGGGHSRERADEPQWSLYPSDSQVSEEVKTRHSEKSQREDEEEEEGENYQKGERGEDSSEEKHLEEPGETQNAFLNERKQASAIKKEELVARSETHAAGHSQEKTHSREKSSQESGEETGSQENHPQESKG
  • Signal peptide:  MQPTLLLSLLGAVGLAAVNS
  • Modification:  T1 Phosphoserine;T8 Sulfotyrosine;T10 Phosphoserine;T15 Phosphoserine
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Secretogranin-1 is a neuroendocrine secretory granule protein, which may be the precursor for other biologically active peptides.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P05060-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006617_AF2.pdbhor006617_ESM.pdb

Physical Information

Mass: 802706 Formula: C299H465N79O111S
Absent amino acids: CGW Common amino acids: E
pI: 3.96 Basic residues: 8
Polar residues: 10 Hydrophobic residues: 17
Hydrophobicity: -120.83 Boman Index: -19343
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 58.67
Instability Index: 5237 Extinction Coefficient cystines: 1490
Absorbance 280nm: 25.25

Literature

  • PubMed ID:  3608978
  • Title:  The primary structure of human secretogranin I (chromogranin B): comparison with chromogranin A reveals homologous terminal domains and a large intervening variable region.
  • PubMed ID:  14702039
  • Title:  Complete sequencing and characterization of 21,243 full-length human cDNAs.
  • PubMed ID:  11780052
  • Title:  The
  • PubMed ID:  15489334
  • Title:  
  • PubMed ID:  1882087
  • Title:  
  • PubMed ID:  7784254
  • Title:  
  • PubMed ID:  3970711
  • Title:  
  • PubMed ID:  3678488
  • Title:  
  • PubMed ID:  14997482
  • Title:  
  • PubMed ID:  16807684
  • Title:  
  • PubMed ID:  23234360
  • Title:  
  • PubMed ID:  24275569
  • Title:  
  • PubMed ID:  26091039
  • Title: