HORDB

General Information

ID: hor006614
Uniprot ID: P01269
Protein name: Parathyroid hormone
Gene name: PTH
Organism: Sus scrofa (Pig)
Family: Parathyroid hormone family
Source: animal
Expression: NA
Disease: NA
Comments: NA
Taxonomy: Sus (genus), Suidae (family), Suina (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
GO MF: GO:0005179 hormone activity; GO:0031856 parathyroid hormone receptor binding; GO:0031857 type 1 parathyroid hormone receptor binding; GO:0048018 receptor ligand activity; GO:0051428 peptide hormone receptor binding
GO BP: GO:0006366 transcription by RNA polymerase II; GO:0006874 intracellular calcium ion homeostasis; GO:0007165 signal transduction; GO:0007189 adenylate cyclase-activating G protein-coupled receptor signaling pathway; GO:0007267 cell-cell signaling; GO:0009059 macromolecule biosynthetic process; GO:0009967 positive regulation of signal transduction; GO:0010468 regulation of gene expression; GO:0010629 negative regulation of gene expression; GO:0010960 magnesium ion homeostasis; GO:0030282 bone mineralization; GO:0030501 positive regulation of bone mineralization; GO:0045725 positive regulation of glycogen biosynthetic process; GO:0045944 positive regulation of transcription by RNA polymerase II; GO:0046326 positive regulation of glucose import; GO:0048873 homeostasis of number of cells within a tissue; GO:0055062 phosphate ion homeostasis; GO:0055074 calcium ion homeostasis; GO:0060732 positive regulation of inositol phosphate biosynthetic process; GO:0071864 positive regulation of cell proliferation in bone marrow; GO:0071866 negative regulation of apoptotic process in bone marrow cell; GO:0090290 positive regulation of osteoclast proliferation
GO CC: GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

Sequence: SVSEIQLMHNLGKHLSSLERVEWLRKKLQDVHNFVALGASIVHRDGGSQRPRKKEDNVLVESHQKSLGEADKAAVDVLIKAKPQ
Length: 84
Propeptide: MMSAKDTVKVMVVMLAICFLARSDGKPIKKRSVSEIQLMHNLGKHLSSLERVEWLRKKLQDVHNFVALGASIVHRDGGSQRPRKKEDNVLVESHQKSLGEADKAAVDVLIKAKPQ
Signal peptide: MMSAKDTVKVMVVMLAICFLARSDG
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Activity

Function: PTH elevates calcium level by dissolving the salts in bone and preventing their renal excretion. Stimulates [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblastic cells (By similarity).
Mechanism: NA
Cross BBB: NA
Target: PTH1R, PTH2R
Target Unid: P50133, F1SST8
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure

Disulfide bond: NA
Structure ID: AF-P01269-F1(AlphaFold_DB_ID)

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor006614_AF2.pdb

hor006614_ESM.pdb

Physical Information

Mass:	1088244	Formula:	C411H681N127O123S
Absent amino acids:	CTY	Common amino acids:	LKV
pI:	10.25	Basic residues:	19
Polar residues:	16	Hydrophobic residues:	30
Hydrophobicity:	-56.9	Boman Index:	-18359
Half-Life:	1.9 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	>10 hour	Aliphatic Index	98.57
Instability Index:	3695	Extinction Coefficient cystines:	5500
Absorbance 280nm:	66.27

Literature

PubMed ID: 3628009
Title: Nucleotide sequence of a full-length cDNA clone encoding preproparathyroid hormone from pig and rat.
PubMed ID: 1164500
Title: Porcine proparathyroid hormone. Identification, biosynthesis, and partial amino acid sequence.
PubMed ID: 4840833
Title: The amino acid sequence of porcine parathyroid hormone.