General Information

  • ID:  hor006608
  • Uniprot ID:  O62694
  • Protein name:  Pro-MCH variant
  • Gene name:  PMCHL1
  • Organism:  Hylobates lar (Common gibbon) (White-handed gibbon)
  • Family:  Melanin-concentrating hormone family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Hylobates (genus), Hylobatidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0030354 melanin-concentrating hormone activity
  • GO BP:  GO:0007165 signal transduction; GO:0007268 chemical synaptic transmission
  • GO CC:  GO:0045202 synapse

Sequence Information

  • Sequence:  KHNFLNHGLSLNLVIKPYLALEGSVAFPAENGVQDTESTQEKRETGDEENSAQFPIGRRDFD
  • Length:  62(1-62)
  • Propeptide:  KHNFLNHGLSLNLVIKPYLALEGSVAFPAENGVQDTESTQEKRETGDEENSAQFPIGRRDFD
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-O62694-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    AF-O62694-F1.pdbhor006608_AF2.pdbhor006608_ESM.pdb

Physical Information

Mass: 801979 Formula: C303H468N86O101
Absent amino acids: CMW Common amino acids: EL
pI: 4.48 Basic residues: 8
Polar residues: 18 Hydrophobic residues: 19
Hydrophobicity: -78.55 Boman Index: -14921
Half-Life / Aliphatic Index: 1.3 hour Aliphatic Index: 70.81
Instability Index: 4045.48 Extinction Coefficient cystines: 1490
Absorbance 280nm: 24.43

Literature

  • PubMed ID:  9491616
  • Title:  Emergence of a brain-expressed variant melanin-concentrating hormone gene during higher primate evolution: a gene "in search of a function".