General Information

  • ID:  hor006591
  • Uniprot ID:  Q7Z4H4
  • Protein name:  Intermedin-short
  • Gene name:  ADM2
  • Organism:  Homo sapiens (Human)
  • Family:  Adrenomedullin family
  • Source:  Human
  • Expression:  Expressed in the esophagus, stomach, jejunum, ileum, ileocecum, ascending colon, transverse colon, descending colon and rectum. Expressed in myocardial cells of the heart, renal tubular cells, hypothalamus, and pituitary.
  • Disease:  Diseases associated with ADM2 include Immunodeficiency 53 and Coronary Stenosis.
  • Comments:  NA
  • Taxonomy:   Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0044877 protein-containing complex binding
  • GO BP:  GO:0001525 angiogenesis; GO:0003073 regulation of systemic arterial blood pressure; GO:0006468 protein phosphorylation; GO:0007189 adenylate cyclase-activating G protein-coupled receptor signaling pathway; GO:0007631 feeding behavior; GO:0010460 positive regulation of heart rate; GO:0010628 positive regulation of gene expression; GO:0045766 positive regulation of angiogenesis; GO:0045776 negative regulation of blood pressure
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  VGCVLGTCQVQNLSHRLWQLMGPAGRQDSAPVDPSSPHSY
  • Length:  40(108-147)
  • Propeptide:  MARIPTAALGCISLLCLQLPGSLSRSLGGDPRPVKPREPPARSPSSSLQPRHPAPRPVVWKLHRALQAQRGAGLAPVMGQPLRDGGRQHSGPRRHSGPRRTQAQLLRVGCVLGTCQVQNLSHRLWQLMGPAGRQDSAPVDPSSPHSYG
  • Signal peptide:  MARIPTAALGCISLLCLQLPGSLS
  • Modification:  T40 Tyrosine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  [Adrenomedullin-2]: May play a role as physiological regulators of gastrointestinal, cardiovascular bioactivities mediated by the CALCRL/RAMPs receptor complexes. Activates the cAMP-dependent pathway.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  45724
  • Structure ID:  AF-Q7Z4H4-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006591_AF2.pdbhor006591_ESM.pdb

Physical Information

Mass: 498866 Formula: C184H288N56O57S3
Absent amino acids: EFIK Common amino acids: S
pI: 7.42 Basic residues: 4
Polar residues: 14 Hydrophobic residues: 11
Hydrophobicity: -30.75 Boman Index: -5465
Half-Life / Aliphatic Index: 100 hour Aliphatic Index: 73
Instability Index: 5151.75 Extinction Coefficient cystines: 7115
Absorbance 280nm: 182.44

Literature

  • PubMed ID:  14615490
  • Title:  Intermedin is a calcitonin/calcitonin gene-related peptide family peptide acting through the calcitonin receptor-like receptor/receptor activity-modifying protein receptor complexes.
  • PubMed ID:  14706825
  • Title:  Identification of novel adrenomedullin in mammals: a potent cardiovascu
  • PubMed ID:  16359754
  • Title:  
  • PubMed ID:  10591208
  • Title: