General Information

  • ID:  hor006568
  • Uniprot ID:  Q17128
  • Protein name:  Hypertrehalosaemic prohormone
  • Gene name:  NA
  • Organism:  Blaberus discoidalis (Tropical cockroach)
  • Family:  AKH/HRTH/RPCH family
  • Source:  Animal
  • Expression:  Expressed in corpora cardiaca.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Blaberus (genus), Blaberinae (subfamily), Blaberidae (family), Blaberoidea (superfamily), Blattodea (order), Dictyoptera (superorder), Polyneoptera (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  QVNFSPGWGTGKRSAVQDSPCKGSAESLMYIYKLVQNEAQKILECEKFSSN
  • Length:  51(22-72)
  • Propeptide:  MNHLVKVLIVVVAIALVLCEAQVNFSPGWGTGKRSAVQDSPCKGSAESLMYIYKLVQNEAQKILECEKFSSN
  • Signal peptide:  MNHLVKVLIVVVAIALVLCEA
  • Modification:  T1 Pyrrolidone carboxylic acid;T10 Threonine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Hypertrehalosaemic factors are neuropeptides that elevate the level of trehalose in the hemolymph (trehalose is the major carbohydrate in the hemolymph of insects).
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q17128-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006568_AF2.pdbhor006568_ESM.pdb

Physical Information

Mass: 654738 Formula: C247H387N67O79S3
Absent amino acids: H Common amino acids: S
pI: 8.21 Basic residues: 6
Polar residues: 19 Hydrophobic residues: 14
Hydrophobicity: -58.24 Boman Index: -8825
Half-Life: 0.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 61.18
Instability Index: 5867.84 Extinction Coefficient cystines: 8605
Absorbance 280nm: 172.1

Literature

  • PubMed ID:  9220026
  • Title:  Hypertrehalosemic hormone in a cockroach: molecular cloning and expression.
  • PubMed ID:  3778476
  • Title:  Insect hypertrehalosemic hormone: isolation and primary structure from Blaberus discoidalis cockroaches.