General Information

  • ID:  hor006561
  • Uniprot ID:  P84715
  • Protein name:  C-type natriuretic peptide 39
  • Gene name:  NA
  • Organism:  Ornithorhynchus anatinus (Duckbill platypus)
  • Family:  Natriuretic peptide family
  • Source:  Animal
  • Expression:  Expressed by the venom gland.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Ornithorhynchus (genus), Ornithorhynchidae (family), Monotremata (order), Prototheria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005267 potassium channel activity; GO:0005272 sodium channel activity; GO:0051427 hormone receptor binding; GO:0090729 toxin activity
  • GO BP:  GO:0006182 cGMP biosynthetic process; GO:0006811 monoatomic ion transport; GO:0006813 potassium ion transport; GO:0006814 sodium ion transport; GO:0007168 receptor guanylyl cyclase signaling pathway; GO:0008217 regulation of blood pressure; GO:0034220 monoatomic ion transmembrane transport; GO:0035725 sodium ion transmembrane transport; GO:0035896 positive regulation of mast cell degranulation in another organism; GO:0042311 vasodilation; GO:0044398 envenomation resulting in induction of edema in another organism; GO:0044619 positive regulation of relaxation of uterine smooth muscle in another organism; GO:0071805 potassium ion transmembrane transport; GO:0097746 blood vessel diameter maintenance
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  LLHDHPNPRKYKPANKKGLSKGCFGLKLDRIGSTSGLGC
  • Length:  39(83-121)
  • Propeptide:  MHLSHLLAWALLLTLLSLRAEAKPPSPQPQVPRSPGDEASEAVAANGGGKKGDKEPKGDRPRLLRELRLDTRSRGSRGVWTRLLHDHPNPRKYKPANKKGLSKGCFGLKLDRIGSTSGLGC
  • Signal peptide:  MHLSHLLAWALLLTLLSLRAEA
  • Modification:  T2 D-leucine
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Venom component with vasorelaxant activity. In vitro stimulates the production of cGMP in rat aortic smooth muscle cells and histamine release from rat peritoneal mast cells. Induces relaxation of isolated rat uterus. Induces local edema following subplan
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P84715-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006561_AF2.pdbhor006561_ESM.pdb

Physical Information

Mass: 488592 Formula: C185H305N57O51S2
Absent amino acids: EMQVW Common amino acids: GKL
pI: 10.58 Basic residues: 10
Polar residues: 15 Hydrophobic residues: 9
Hydrophobicity: -70.51 Boman Index: -6866
Half-Life: 5.5 hour Half-Life Yeast: 3 min
Half-Life E.Coli: 2 min Aliphatic Index 72.56
Instability Index: 476.92 Extinction Coefficient cystines: 1615
Absorbance 280nm: 42.5

Literature

  • PubMed ID:  18464734
  • Title:  Genome analysis of the platypus reveals unique signatures of evolution.
  • PubMed ID:  19928958
  • Title:  Duck-billed platypus venom peptides induce Ca2+ influx in neuroblastoma cells.
  • PubMed ID:  9827022
  • Title:  A C-type natriuretic peptide from the venom of the platypus (Ornithorhynchus anatinus): structure and
  • PubMed ID:  7597719
  • Title:  
  • PubMed ID:  9663691
  • Title:  
  • PubMed ID:  10409107
  • Title:  
  • PubMed ID:  10381585
  • Title:  
  • PubMed ID:  12135762
  • Title:  
  • PubMed ID:  12175607
  • Title: