General Information

  • ID:  hor006557
  • Uniprot ID:  P61364
  • Protein name:  Osteocrin
  • Gene name:  Ostn
  • Organism:  Mus musculus (Mouse)
  • Family:  Osteocrin family
  • Source:  animal
  • Expression:  Is regulated by nutritional changes . |Expressed during matrix production and maturation. Also expressed during myocyte differentiation. |Expressed in skeletal muscle and to a much lesser extent in bone, brown adipose tissue, spleen and testis .
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Mus (subgenus), Mus (genus), Murinae (subfamily), Muridae (family), Muroidea , Myomorpha (suborder), Rodentia (order), Glires , Euarchontoglires (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005102 signaling receptor binding; GO:0005179 hormone activity
  • GO BP:  GO:0001503 ossification; GO:0003416 endochondral bone growth; GO:0007166 cell surface receptor signaling pathway; GO:0009755 hormone-mediated signaling pathway; GO:0030154 cell differentiation; GO:0030500 regulation of bone mineralization; GO:0045668 negative regulation of osteoblast differentiation; GO:0046325 negative regulation of glucose import; GO:1903860 negative regulation of dendrite extension
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  SFSGFGSPLDRLSAGSVEHRGKQRKAVDHSKKRFGIPMDRIGRNRLSSSR
  • Length:  50
  • Propeptide:  MLDWRLASTHFILAMIVMLWGSGKAFSVDLASQEFGTASLQSPPTAREEKSATELSAKLLRLDDLVSLENDVFETKKKRSFSGFGSPLDRLSAGSVEHRGKQRKAVDHSKKRFGIPMDRIGRNRLSSSRG
  • Signal peptide:  MLDWRLASTHFILAMIVMLWGSGKA
  • Modification:  T50 Arginine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Hormone that acts as a ligand for natriuretic peptide receptor NPR3/NPR-C and promotes bone growth and physical endurance in muscle. Acts as a regulator of osteoblast differentiation and bone growth by binding to natriuretic peptide receptor NPR3/NPR-C, thereby preventing binding between NPR3/NPR-C and natriuretic peptides, leading to increase cGMP production (PubMed:14523025, PubMed:17951249). Required to enhance physical endurance: induced following physical exercise in muscle and promotes cGMP production, probably by interacting with NPR3/NPR-C (PubMed:26668395). May act as an autocrine and paracrine factor linked to glucose metabolism in skeletal muscle (PubMed:15044443).
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  Npr3
  • Target Unid:  P70180
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P61364-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor006557_AF2.pdbhor006557_ESM.pdb

Physical Information

Mass: 644444 Formula: C237H392N84O70S
Absent amino acids: CTWY Common amino acids: SR
pI: 12.31 Basic residues: 14
Polar residues: 16 Hydrophobic residues: 12
Hydrophobicity: -98.2 Boman Index: -17340
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 54.6
Instability Index: 2916 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  14523025
  • Title:  Osteocrin, a novel bone-specific secreted protein that modulates the osteoblast phenotype.
  • PubMed ID:  15044443
  • Title:  Musclin, a novel skeletal muscle-derived secretory factor.
  • PubMed ID:  15489334
  • Title:  The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
  • PubMed ID:  17951249
  • Title:  Osteocrin is a specific ligand of the natriuretic Peptide clearance receptor that modulates bone growth.
  • PubMed ID:  26668395
  • Title:  Musclin is an activity-stimulated myokine that enhances physical endurance.
  • PubMed ID:  27830782
  • Title:  Evolution of Osteocrin as an activity-regulated factor in the primate brain.