HORDB

ID: hor006555
Uniprot ID: P61312
Protein name: Adrenomedullin-2
Gene name: Adm2
Organism: Rattus norvegicus (Rat)
Family: Adrenomedullin family
Source: Animal
Expression: Expression was restricted to the intermediate and anterior lobes of the pituitary.
Disease: NA
Comments: NA
Taxonomy: Rattus (genus), Murinae (subfamily), Muridae (family), Muroidea , Myomorpha (suborder), Rodentia (order), Glires , Euarchontoglires (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
GO MF: GO:0005179 hormone activity; GO:0044877 protein-containing complex binding
GO BP: GO:0001525 angiogenesis; GO:0003073 regulation of systemic arterial blood pressure; GO:0007189 adenylate cyclase-activating G protein-coupled receptor signaling pathway; GO:0007631 feeding behavior; GO:0010460 positive regulation of heart rate; GO:0010628 positive regulation of gene expression; GO:0045766 positive regulation of angiogenesis; GO:0045776 negative regulation of blood pressure
GO CC: GO:0005576 extracellular region

Sequence: PHAQLLRVGCVLGTCQVQNLSHRLWQLVRPSGRRDSAPVDPSSPHSY
Length: 47(99-145)
Propeptide: MAQLLMVTVTFGCISLLYLLPGTLSGSLGKGLRPREPPAKIPSSGPQPGHPSLRPVVWKPPHALQPQGRGNPALATVHLPQGGGSRHPGPQRHVGSRRPHAQLLRVGCVLGTCQVQNLSHRLWQLVRPSGRRDSAPVDPSSPHSYG
Signal peptide: MAQLLMVTVTFGCISLLYLLPGTLS
Modification: T47 Tyrosine amide
Glycosylation: NA
Mutagenesis: NA

Function: [Adrenomedullin-2]: May play a role as physiological regulators of gastrointestinal, cardiovascular bioactivities mediated by the CALCRL/RAMPs receptor complexes. Activates the cAMP-dependent pathway.
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor006555_AF2.pdb

hor006555_ESM.pdb

Mass:	604061	Formula:	C226H362N74O65S2
Absent amino acids:	EFIKM	Common amino acids:	LS
pI:	9.59	Basic residues:	8
Polar residues:	14	Hydrophobic residues:	14
Hydrophobicity:	-44.89	Boman Index:	-9688
Half-Life:	>20 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	?	Aliphatic Index	84.89
Instability Index:	5752.13	Extinction Coefficient cystines:	7115
Absorbance 280nm:	154.67

PubMed ID: 14706825
Title: Identification of novel adrenomedullin in mammals: a potent cardiovascular and renal regulator.
PubMed ID: 14615490
Title: Intermedin is a calcitonin/calcitonin gene-related peptide family peptide acting through the calcitonin receptor-like receptor/receptor activity-modifying pro
PubMed ID: 26479776
Title: