General Information

  • ID:  hor006554
  • Uniprot ID:  P56174
  • Protein name:  Probable insulin-like peptide beta-type 5
  • Gene name:  ins-6
  • Organism:  Caenorhabditis elegans
  • Family:  Insulin family
  • Source:  Animal
  • Expression:  Expressed by ASI and ASJ sensory neurons.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Caenorhabditis (genus), Peloderinae (subfamily), Rhabditidae (family), Rhabditoidea (superfamily), Rhabditomorpha (infraorder), Rhabditina (suborder), Rhabditida (order), Chromadorea (class), Nematoda (phylum), Ecdysozoa , Protostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005158 insulin receptor binding; GO:0005179 hormone activity
  • GO BP:  GO:0007635 chemosensory behavior; GO:0008286 insulin receptor signaling pathway; GO:0008355 olfactory learning; GO:0008582 regulation of synaptic assembly at neuromuscular junction; GO:0040024 dauer larval development; GO:1902075 cellular response to salt; GO:1905910 negative regulation of dauer entry
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  VPAPGETRACGRKLISLVMAVCGDLCNPQEGKDIATECCGNQCSDDYIRSACCP
  • Length:  54(59-112)
  • Propeptide:  MNSVFTIIFVLCALQVAASFRQSFGPSMSEESASMQLLRELQHNMMESAHRPMPRARRVPAPGETRACGRKLISLVMAVCGDLCNPQEGKDIATECCGNQCSDDYIRSACCP
  • Signal peptide:  MNSVFTIIFVLCALQVAAS
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Probable insulin-like peptide which negatively regulates synapse development at the neuromuscular junctions (PubMed:23665919). Probably acts as a daf-2/InsR agonist ligand to prevent dauer formation under optimal environmental conditions (PubMed:24671950)
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  10-39; 22-52; 26-53; 38-43
  • Structure ID:  AF-P56174-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006554_AF2.pdbhor006554_ESM.pdb

Physical Information

Mass: 660908 Formula: C230H379N69O79S9
Absent amino acids: FHW Common amino acids: C
pI: 4.43 Basic residues: 5
Polar residues: 21 Hydrophobic residues: 14
Hydrophobicity: -9.07 Boman Index: -8303
Half-Life / Aliphatic Index: 100 hour Aliphatic Index: 68.7
Instability Index: 6017.59 Extinction Coefficient cystines: 1990
Absorbance 280nm: 37.55

Literature

  • PubMed ID:  9851916
  • Title:  Genome sequence of the nematode C. elegans: a platform for investigating biology.
  • PubMed ID:  9548970
  • Title:  New insulin-like proteins with atypical disulfide bond pattern characterized in Caenorhabditis elegans by comparative sequence analysis and homology modeling.
  • PubMed ID:  23665919
  • Title:  Attenuation
  • PubMed ID:  24013594
  • Title:  
  • PubMed ID:  24671950
  • Title:  
  • PubMed ID:  12670864
  • Title: