General Information

  • ID:  hor006552
  • Uniprot ID:  P55246
  • Protein name:  Progonadoliberin-3
  • Gene name:  gnrh3
  • Organism:  Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)
  • Family:  GnRH family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Oncorhynchus (genus), Salmoninae (subfamily), Salmonidae (family), Salmoniformes (order), Protacanthopterygii, Euteleosteomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  QHWSYGWLPGGKRSVGELEATIKMMDTGGVVVLPEETSAHVSERLRPYDVILKKWMPHK
  • Length:  59(16-74)
  • Propeptide:  VQVVVLALVAQVTLSQHWSYGWLPGGKRSVGELEATIKMMDTGGVVVLPEETSAHVSERLRPYDVILKKWMPHK
  • Signal peptide:  VQVVVLALVAQVTLS
  • Modification:  T1 Pyrrolidone carboxylic acid;T10 Glycine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Stimulates the secretion of gonadotropins.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P55246-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006552_AF2.pdbhor006552_ESM.pdb

Physical Information

Mass: 776751 Formula: C304H475N83O84S3
Absent amino acids: CFN Common amino acids: GVEKL
pI: 9.07 Basic residues: 11
Polar residues: 15 Hydrophobic residues: 18
Hydrophobicity: -46.61 Boman Index: -8313
Half-Life: 0.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 79.15
Instability Index: 6936.61 Extinction Coefficient cystines: 19480
Absorbance 280nm: 335.86

Literature

  • PubMed ID:  1308825
  • Title:  Fish gonadotropin-releasing hormone gene and molecular approaches for control of sexual maturation: development of a transgenic fish model.