General Information

  • ID:  hor006550
  • Uniprot ID:  P51923
  • Protein name:  Progonadoliberin-3
  • Gene name:  gnrh3
  • Organism:  Sparus aurata (Gilthead sea bream)
  • Family:  GnRH family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Sparus (genus), Sparidae (family), Spariformes (order), Eupercaria, Percomorphaceae, Euacanthomorphacea, Acanthomorphata, Ctenosquamata, Eurypterygia, Neoteleostei, Euteleosteomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  QHWSYGWLPGGKRSVGELEATIRMMGTGGVVSLPEEASAQTQERLRPYNVIKDDSSPFDRKKRFPNK
  • Length:  67(24-90)
  • Propeptide:  MEASSRVTVQVLLLALVVQVTLSQHWSYGWLPGGKRSVGELEATIRMMGTGGVVSLPEEASAQTQERLRPYNVIKDDSSPFDRKKRFPNK
  • Signal peptide:  MEASSRVTVQVLLLALVVQVTLS
  • Modification:  T1 Pyrrolidone carboxylic acid;T10 Glycine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Stimulates the secretion of gonadotropins.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P51923-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006550_AF2.pdbhor006550_ESM.pdb

Physical Information

Mass: 876894 Formula: C334H525N99O100S2
Absent amino acids: C Common amino acids: GRS
pI: 10.16 Basic residues: 12
Polar residues: 20 Hydrophobic residues: 17
Hydrophobicity: -91.79 Boman Index: -16742
Half-Life / Aliphatic Index: 0.8 hour Aliphatic Index: 56.72
Instability Index: 6693.43 Extinction Coefficient cystines: 13980
Absorbance 280nm: 211.82

Literature

  • PubMed ID:  9843645
  • Title:  Levels of the native forms of GnRH in the pituitary of the gilthead seabream, Sparus aurata, at several characteristic stages of the gonadal cycle.