General Information

  • ID:  hor006547
  • Uniprot ID:  P51922
  • Protein name:  GnRH-associated peptide 3
  • Gene name:  gnrh3
  • Organism:  Porichthys notatus (Plainfin midshipman)
  • Family:  GnRH family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Porichthys (genus), Porichthyinae (subfamily), Batrachoididae (family), Batrachoidiformes (order), Batrachoidaria, Percomorphaceae, Euacanthomorphacea, Acanthomorphata, Ctenosquamata, Eurypterygia, Neoteleostei, Euteleosteomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  SVGELEATIRMMGTGGVVSLPEETSAQTQERLRPYNIINDGGYFNRKKRFFHE
  • Length:  53(37-89)
  • Propeptide:  MRPYNVIVVMVVLLALVLHAVLSQHWSYGWLPGGKRSVGELEATIRMMGTGGVVSLPEETSAQTQERLRPYNIINDGGYFNRKKRFFHE
  • Signal peptide:  MRPYNVIVVMVVLLALVLHAVLS
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Stimulates the secretion of gonadotropins.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P51922-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006547_AF2.pdbhor006547_ESM.pdb

Physical Information

Mass: 695944 Formula: C263H415N77O82S2
Absent amino acids: CW Common amino acids: EGR
pI: 7.54 Basic residues: 8
Polar residues: 18 Hydrophobic residues: 14
Hydrophobicity: -67.17 Boman Index: -12716
Half-Life / Aliphatic Index: 1.9 hour Aliphatic Index: 64.34
Instability Index: 4307.92 Extinction Coefficient cystines: 2980
Absorbance 280nm: 57.31

Literature

  • PubMed ID:  7657161
  • Title:  Structure, localization, and molecular phylogeny of a GnRH cDNA from a paracanthopterygian fish, the plainfin midshipman (Porichthys notatus).