General Information

  • ID:  hor006540
  • Uniprot ID:  P35808
  • Protein name:  Adipokinetic prohormone type 2
  • Gene name:  NA
  • Organism:  Schistocerca gregaria (Desert locust) (Gryllus gregarius)
  • Family:  AKH/HRTH/RPCH family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Schistocerca (genus), Cyrtacanthacridinae (subfamily), Acrididae (family), Acridoidea (superfamily), Acridomorpha, Acrididea (infraorder), Caelifera (suborder), Orthoptera (order), Polyneoptera (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0007629 flight behavior
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  QLNFSTGWGRRYADPNADPMAFLTKLIQIEARKLSGCSN
  • Length:  39(1-39)
  • Propeptide:  QLNFSTGWGRRYADPNADPMAFLTKLIQIEARKLSGCSN
  • Signal peptide:  NA
  • Modification:  T1 Pyrrolidone carboxylic acid;T8 Tryptophan amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  This hormone, released from cells in the corpora cardiaca, causes release of diglycerides from the fat body and stimulation of muscles to use these diglycerides as an energy source during energy-demanding processes.
  • Mechanism:  NA
  • Cross BBB:  NO
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  37-37
  • Structure ID:  AF-P35808-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    AF-P35808-F1.pdbhor006540_AF2.pdbhor006540_ESM.pdb

Physical Information

Mass: 504896 Formula: C192H302N56O57S2
Absent amino acids: HV Common amino acids: AL
pI: 9.4 Basic residues: 5
Polar residues: 13 Hydrophobic residues: 13
Hydrophobicity: -46.92 Boman Index: -7509
Half-Life / Aliphatic Index: 0.8 hour Aliphatic Index: 70.26
Instability Index: 2683.33 Extinction Coefficient cystines: 6990
Absorbance 280nm: 183.95

Literature

  • PubMed ID:  1941082
  • Title:  Regulation of neuropeptide stoichiometry in neurosecretory cells.
  • PubMed ID:  4063072
  • Title:  Primary structures of locust adipokinetic hormones II.