General Information

  • ID:  hor006538
  • Uniprot ID:  P32648
  • Protein name:  Intestinal peptide PHI-42
  • Gene name:  Vip
  • Organism:  Mus musculus (Mouse)
  • Family:  Glucagon family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Mus (subgenus), Mus (genus), Murinae (subfamily), Muridae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005102 signaling receptor binding; GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity; GO:0051428 peptide hormone receptor binding
  • GO BP:  GO:0001878 response to yeast; GO:0001938 positive regulation of endothelial cell proliferation; GO:0007189 adenylate cyclase-activating G protein-coupled receptor signaling pathway; GO:0007200 phospholipase C-activating G protein-coupled receptor signaling pathway; GO:0007611 learning or memory; GO:0009966 regulation of signal transduction; GO:0019731 antibacterial humoral response; GO:0019732 antifungal humoral response; GO:0032812 positive regulation of epinephrine secretion; GO:0032879 regulation of localization; GO:0032880 regulation of protein localization; GO:0043066 negative regulation of apoptotic process; GO:0043267 negative regulation of potassium ion transport; GO:0045087 innate immune response; GO:0045732 positive regulation of protein catabolic process; GO:0048242 epinephrine secretion; GO:0048255 mRNA stabilization; GO:0048662 negative regulation of smooth muscle cell proliferation; GO:0050829 defense response to Gram-negative bacterium; GO:0050830 defense response to Gram-positive bacterium; GO:0060406 positive regulation of penile erection; GO:0061844 antimicrobial humoral immune response mediated by antimicrobial peptide; GO:0070459 prolactin secretion
  • GO CC:  GO:0005576 extracellular region; GO:0043005 neuron projection; GO:0043025 neuronal cell body

Sequence Information

  • Sequence:  HADGVFTSDYSRLLGQISAKKYLESLIGKRISSSISEDPVPI
  • Length:  42(81-122)
  • Propeptide:  MEARSKPQFLAFLILFSVLFSQSLAWPLFGPPSVVRLDDRMPFEGAGDPDQVSLKADSDILQNPLAENGTPYYDVSRNARHADGVFTSDYSRLLGQISAKKYLESLIGKRISSSISEDPVPIKRHSDAVFTDNYTRLRKQMAVKKYLNSILNGKRSSEGDSADFLEELEK
  • Signal peptide:  MEARSKPQFLAFLILFSVLFS
  • Modification:  T27 Isoleucine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  VIP causes vasodilation, lowers arterial blood pressure, stimulates myocardial contractility, increases glycogenolysis and relaxes the smooth muscle of trachea, stomach and gall bladder.; PHM-27 is a potent agonist of the calcitonin receptor CALCR, with s
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  Vipr2, Vipr1
  • Target Unid:   P41588, P97751
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P32648-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006538_AF2.pdbhor006538_ESM.pdb

Physical Information

Mass: 531067 Formula: C204H330N54O65
Absent amino acids: CMNW Common amino acids: S
pI: 7.53 Basic residues: 6
Polar residues: 14 Hydrophobic residues: 14
Hydrophobicity: -15.48 Boman Index: -6474
Half-Life / Aliphatic Index: 3.5 hour Aliphatic Index: 102.14
Instability Index: 5016.67 Extinction Coefficient cystines: 2980
Absorbance 280nm: 72.68

Literature

  • PubMed ID:  1851524
  • Title:  Characterization of the gene and messages for vasoactive intestinal polypeptide (VIP) in rat and mouse.
  • PubMed ID:  16141072
  • Title:  The transcriptional landscape of the mammalian genome.
  • PubMed ID:  15489334
  • Title:  The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Col
  • PubMed ID:  7894056
  • Title:  
  • PubMed ID:  8402943
  • Title: