HORDB

General Information

ID: hor006524
Uniprot ID: P01186
Protein name: Copeptin
Gene name: Avp
Organism: Rattus norvegicus (Rat)
Family: Vasopressin/oxytocin family
Source: animal
Expression: NA
Disease: NA
Comments: NA
Taxonomy: Rattus (genus), Murinae (subfamily), Muridae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0004672 protein kinase activity; GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity; GO:0005185 neurohypophyseal hormone activity; GO:0005515 protein binding; GO:0031894 V1A vasopressin receptor binding; GO:0031895 V1B vasopressin receptor binding; GO:0031896 V2 vasopressin receptor binding; GO:0043027 cysteine-type endopeptidase inhibitor activity involved in apoptotic process
GO BP: GO:0001659 temperature homeostasis; GO:0002125 maternal aggressive behavior; GO:0003084 positive regulation of systemic arterial blood pressure; GO:0007165 signal transduction; GO:0007204 positive regulation of cytosolic calcium ion concentration; GO:0007621 negative regulation of female receptivity; GO:0007625 grooming behavior; GO:0007626 locomotory behavior; GO:0008284 positive regulation of cell population proliferation; GO:0010628 positive regulation of gene expression; GO:0014049 positive regulation of glutamate secretion; GO:0014070 response to organic cyclic compound; GO:0030307 positive regulation of cell growth; GO:0031394 positive regulation of prostaglandin biosynthetic process; GO:0032849 positive regulation of cellular pH reduction; GO:0033138 positive regulation of peptidyl-serine phosphorylation; GO:0033574 response to testosterone; GO:0035094 response to nicotine; GO:0035176 social behavior; GO:0042310 vasoconstriction; GO:0042711 maternal behavior; GO:0043066 negative regulation of apoptotic process; GO:0045471 response to ethanol; GO:0045907 positive regulation of vasoconstriction; GO:0046718 symbiont entry into host cell; GO:0050891 multicellular organismal-level water homeostasis; GO:0051970 negative regulation of transmission of nerve impulse; GO:0070371 ERK1 and ERK2 cascade; GO:0070528 protein kinase C signaling; GO:0090201 negative regulation of release of cytochrome c from mitochondria; GO:0097746 blood vessel diameter maintenance
GO CC: GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0030141 secretory granule; GO:0030425 dendrite; GO:0098992 neuronal dense core vesicle

Sequence Information

Sequence: AREQSNATQLDGPARELLLRLVQLAGTQESVDSAKPRVY
Length: 39
Propeptide: MLAMMLNTTLSACFLSLLALTSACYFQNCPRGGKRATSDMELRQCLPCGPGGKGRCFGPSICCADELGCFLGTAEALRCQEENYLPSPCQSGQKPCGSGGRCAAAGICCSDESCVAEPECREGFFRLTRAREQSNATQLDGPARELLLRLVQLAGTQESVDSAKPRVY
Signal peptide: MLAMMLNTTLSACFLSLLALTSA
Modification: NA
Glycosylation: T6 N-linked (GlcNAc...) asparagine
Mutagenesis: NA

Activity

Function: Neurophysin 2 specifically binds vasopressin.; Vasopressin has a direct antidiuretic action on the kidney, it also causes vasoconstriction of the peripheral vessels. Acts by binding to vasopressin receptors (V1bR/AVPR1B, V1aR/AVPR1A, and V2R/AVPR2) (By similarity).
Mechanism: NA
Cross BBB: NA
Target: Avpr2, Avpr1a
Target Unid: Q00788, P30560
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure

Disulfide bond: NA
Structure ID: AF-P01186-F1(AlphaFold_DB_ID)

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor006524_AF2.pdb

hor006524_ESM.pdb

Physical Information

Mass:	495979	Formula:	C183H307N57O61
Absent amino acids:	CFHIMW	Common amino acids:	L
pI:	6.67	Basic residues:	5
Polar residues:	9	Hydrophobic residues:	14
Hydrophobicity:	-55.38	Boman Index:	-9481
Half-Life:	4.4 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	>10 hour	Aliphatic Index	95.13
Instability Index:	3494.36	Extinction Coefficient cystines:	1490
Absorbance 280nm:	39.21

Literature

PubMed ID: 1706187
Title: Rat vasopressin and oxytocin genes are linked by a long interspersed repeated DNA element (LINE): sequence and transcriptional analysis of LINE.
PubMed ID: 3768139
Title: The neurohypophyseal hormones vasopressin and oxytocin. Precursor structure, synthesis and regulation.
PubMed ID: 6315416
Title: Structural organization of the rat gene for the arginine vasopressin-neurophysin precursor.
PubMed ID: 6526016
Title: The mutant vasopressin gene from diabetes insipidus (Brattleboro) rats is transcribed but the message is not efficiently translated.
PubMed ID: 5150741
Title: [Evolution of neurohypophyseal hormones: isolation of active principles from rabbits and rats].
PubMed ID: 7036996
Title: Identification of rat neurophysins: complete amino acid sequences of MSEL- and VLDV-neurophysins.
PubMed ID: 891987
Title: A comparative study of partial neurophysin protein sequences of cod, guinea pig, rat and sheep.
PubMed ID: 6641941
Title: The glycopeptide domain of the rat vasopressin precursor.
PubMed ID: 3956504
Title: Isolation and primary structure of novel neurointermediate pituitary peptides derived from the C-terminal of the rat vasopressin-neurophysin precursor (propressophysin).