HORDB

ID: hor006522
Uniprot ID: P01183
Protein name: Copeptin
Gene name: AVP
Organism: Sus scrofa (Pig)
Family: Vasopressin/oxytocin family
Source: animal
Expression: NA
Disease: NA
Comments: NA
Taxonomy: Sus (genus), Suidae (family), Suina (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity; GO:0005185 neurohypophyseal hormone activity; GO:0031894 V1A vasopressin receptor binding
GO BP: GO:0007165 signal transduction; GO:0042310 vasoconstriction; GO:0097746 blood vessel diameter maintenance
GO CC: GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0030141 secretory granule

Sequence: ASDRSNATLLDGPSGALLLRLVQLAGAPEPAEPAQPGVY
Length: 39
Propeptide: MPDATLPACFLGLLALTSACYFQNCPKGGKRAMSDLELRQCLPCGPGGKGRCFGPSICCGDELGCFVGTAEALRCQEENYLPSPCQSGQKPCGSGGRCAAAGICCNDESCVTEPECREGASFLRRARASDRSNATLLDGPSGALLLRLVQLAGAPEPAEPAQPGVY
Signal peptide: MPDATLPACFLGLLALTSA
Modification: NA
Glycosylation: T6 N-linked (GlcNAc...) asparagine
Mutagenesis: NA

Function: Neurophysin 2 specifically binds vasopressin.; Vasopressin has a direct antidiuretic action on the kidney, it also causes vasoconstriction of the peripheral vessels. Acts by binding to vasopressin receptors (V1bR/AVPR1B, V1aR/AVPR1A, and V2R/AVPR2) (By similarity).
Mechanism: NA
Cross BBB: NA
Target: AVPR2, AVPR1A
Target Unid: P32307, A0A286ZX01
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor006522_AF2.pdb

hor006522_ESM.pdb

Mass:	459441	Formula:	C172H280N48O56
Absent amino acids:	CFHIKMW	Common amino acids:	AL
pI:	4.11	Basic residues:	2
Polar residues:	10	Hydrophobic residues:	16
Hydrophobicity:	0.26	Boman Index:	-3258
Half-Life:	4.4 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	>10 hour	Aliphatic Index	102.82
Instability Index:	5675.38	Extinction Coefficient cystines:	1490
Absorbance 280nm:	39.21

PubMed ID: 3768139
Title: The neurohypophyseal hormones vasopressin and oxytocin. Precursor structure, synthesis and regulation.
PubMed ID: 1971513
Title: Poly(A) tail length of oxytocin- and lysine vasopressin-encoding mRNAs increases during development in the porcine hypothalamus.
PubMed ID: 4940405
Title: Amino acid sequence of porcine neurophysin-I.
PubMed ID: 944186
Title: Characterization of porcine neurophysin. III. Its resemblance and possible relationship to porcine neurophysin I.
PubMed ID: 1001445
Title: Characterization of porcine MSEL-neurophysin.
PubMed ID: 465021
Title: A new glycopeptide in pig, ox and sheep pituitary.
PubMed ID: 4673067
Title: A glycopeptide from the posterior lobe of pig pituitaries. 2. Primary structure.