General Information

  • ID:  hor006520
  • Uniprot ID:  P01180
  • Protein name:  Copeptin
  • Gene name:  AVP
  • Organism:  Bos taurus (Bovine)
  • Family:  Vasopressin/oxytocin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Bos (genus), Bovinae (subfamily), Bovidae (family), Pecora (infraorder), Ruminantia (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity; GO:0005185 neurohypophyseal hormone activity; GO:0031894 V1A vasopressin receptor binding
  • GO BP:  GO:0007165 signal transduction; GO:0042310 vasoconstriction; GO:0097746 blood vessel diameter maintenance
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0030141 secretory granule

Sequence Information

  • Sequence:  ANDRSNATLLDGPSGALLLRLVQLAGAPEPAEPAQPGVY
  • Length:  39(128-166)
  • Propeptide:  MPDATLPACFLSLLAFTSACYFQNCPRGGKRAMSDLELRQCLPCGPGGKGRCFGPSICCGDELGCFVGTAEALRCQEENYLPSPCQSGQKPCGSGGRCAAAGICCNDESCVTEPECREGVGFPRRVRANDRSNATLLDGPSGALLLRLVQLAGAPEPAEPAQPGVY
  • Signal peptide:  MPDATLPACFLSLLAFTSA
  • Modification:  NA
  • Glycosylation:  T6 N-linked (GlcNAc...) asparagine
  • Mutagenesis:  NA

Activity

  • Function:  Neurophysin 2 specifically binds vasopressin.; Vasopressin has a direct antidiuretic action on the kidney, it also causes vasoconstriction of the peripheral vessels. Acts by binding to vasopressin receptors (V1bR/AVPR1B, V1aR/AVPR1A, and V2R/AVPR2) (By si
  • Mechanism:  Fetal neurophysin is the major neurophysin present in the neurohypophysis of 7 to 9 month fetuses and its sequence appears to be identical with that of the adult.
  • Cross BBB:  NA
  • Target:  AVPR2, AVPR1A
  • Target Unid:  P48044, F6PV87
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P01180-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006520_AF2.pdbhor006520_ESM.pdb

Physical Information

Mass: 462144 Formula: C173H281N49O56
Absent amino acids: CFHIKMW Common amino acids: AL
pI: 4.11 Basic residues: 2
Polar residues: 10 Hydrophobic residues: 16
Hydrophobicity: -6.67 Boman Index: -3582
Half-Life: 4.4 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 102.82
Instability Index: 5675.38 Extinction Coefficient cystines: 1490
Absorbance 280nm: 39.21

Literature

  • PubMed ID:  6276766
  • Title:  Nucleotide sequence of cloned cDNA encoding bovine arginine vasopressin-neurophysin II precursor.
  • PubMed ID:  6709064
  • Title:  Recent gene conversion involving bovine vasopressin and oxytocin precursor genes suggested by nucleotide sequence.
  • PubMed ID:  3768139
  • Title:  The neurohypophyseal hormones vasopressi
  • PubMed ID:  13115463
  • Title:  
  • PubMed ID:  3318825
  • Title:  
  • PubMed ID:  1252249
  • Title:  
  • PubMed ID:  1248642
  • Title:  
  • PubMed ID:  4564211
  • Title:  
  • PubMed ID:  465021
  • Title:  
  • PubMed ID:  2034668
  • Title:  
  • PubMed ID:  8564543
  • Title: