General Information

  • ID:  hor006515
  • Uniprot ID:  O62691
  • Protein name:  Pro-MCH
  • Gene name:  PMCH
  • Organism:  Carlito syrichta (Philippine tarsier) (Tarsius syrichta)
  • Family:  Melanin-concentrating hormone family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Carlito (genus), Tarsiidae (family), Tarsiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0030354 melanin-concentrating hormone activity
  • GO BP:  GO:0007165 signal transduction; GO:0007268 chemical synaptic transmission
  • GO CC:  GO:0005576 extracellular region; GO:0045202 synapse

Sequence Information

  • Sequence:  ILLSASKSIRNLEDDMVFNTFRLGKAFQKEDTAEKSVVAPSLEQYKNDENS
  • Length:  51(21-71)
  • Propeptide:  AKMSLSSYILILTLVLFSQGILLSASKSIRNLEDDMVFNTFRLGKAFQKEDTAEKSVVAPSLEQYKNDENS
  • Signal peptide:  AKMSLSSYILILTLVLFSQG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-O62691-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006515_AF2.pdbhor006515_ESM.pdb

Physical Information

Mass: 667046 Formula: C252H404N68O85S
Absent amino acids: CHW Common amino acids: SEKL
pI: 4.59 Basic residues: 7
Polar residues: 14 Hydrophobic residues: 17
Hydrophobicity: -63.53 Boman Index: -12381
Half-Life / Aliphatic Index: 20 hour Aliphatic Index: 78.43
Instability Index: 2937.06 Extinction Coefficient cystines: 1490
Absorbance 280nm: 29.8

Literature

  • PubMed ID:  9491616
  • Title:  Emergence of a brain-expressed variant melanin-concentrating hormone gene during higher primate evolution: a gene "in search of a function".