General Information

  • ID:  hor006511
  • Uniprot ID:  O09163
  • Protein name:  GnRH-associated peptide 1
  • Gene name:  GNRH1
  • Organism:  Mesocricetus auratus (Golden hamster)
  • Family:  GnRH family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Mesocricetus (genus), Cricetinae (subfamily), Cricetidae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005183 gonadotropin hormone-releasing hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  NAERLGDSFQEMDKEVDQLAEPQHLECTVHWPRSPLRDLRGVLESLIEEE
  • Length:  50(14-63)
  • Propeptide:  QHWSYGLRPGGKRNAERLGDSFQEMDKEVDQLAEPQHLECTVHWPRSPLRDLRGVLESLIEEE
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Stimulates the secretion of gonadotropins; it stimulates the secretion of both luteinizing and follicle-stimulating hormones.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-O09163-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006511_AF2.pdbhor006511_ESM.pdb

Physical Information

Mass: 672065 Formula: C251H396N72O85S2
Absent amino acids: Y Common amino acids: E
pI: 4.14 Basic residues: 7
Polar residues: 8 Hydrophobic residues: 15
Hydrophobicity: -85.8 Boman Index: -14083
Half-Life / Aliphatic Index: 1.4 hour Aliphatic Index: 83.8
Instability Index: 8299 Extinction Coefficient cystines: 5500
Absorbance 280nm: 112.24

Literature

  • PubMed ID:  NA
  • Title:  NA