General Information

  • ID:  hor006504
  • Uniprot ID:  Q9WUK0
  • Protein name:  Insulin-like 3 A chain
  • Gene name:  Insl3
  • Organism:  Rattus norvegicus (Rat)
  • Family:  Insulin family
  • Source:  Animal
  • Expression:  Highly expressed in adult testis and low expression in the ovary. Highly up-regulated in testes of day 19 embryos, but not in later neonatal stages, nor any ovarian tissue from this period. |Expressed in Leydig cells of the testis, and weakly in the theca
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Rattus (genus), Murinae (subfamily), Muridae (family), Muroidea , Myomorpha (suborder), Rodentia (order), Glires , Euarchontoglires (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0001664 G protein-coupled receptor binding; GO:0002020 protease binding; GO:0005179 hormone activity
  • GO BP:  GO:0001556 oocyte maturation; GO:0001701 in utero embryonic development; GO:0007193 adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway; GO:0008284 positive regulation of cell population proliferation; GO:0008285 negative regulation of cell population proliferation; GO:0008584 male gonad development; GO:0010634 positive regulation of epithelial cell migration; GO:0043066 negative regulation of apoptotic process; GO:0043950 positive regulation of cAMP-mediated signaling; GO:0090303 positive regulation of wound healing; GO:2000018 regulation of male gonad development
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0048471 perinuclear region of cytoplasm

Sequence Information

  • Sequence:  SVATNAVHRCCLTGCTQQDLLGLCPH
  • Length:  26(103-128)
  • Propeptide:  MHALLLLLLLALGSALRSPQPPEARAKLCGHHLVRALVRVCGGPRWSPEATQPVDTRDRELLQWLEQRHLLHALVADADPALDPDPALDPQLPHQASQRQRRSVATNAVHRCCLTGCTQQDLLGLCPH
  • Signal peptide:  MHALLLLLLLALGSA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Seems to play a role in testicular function. May be a trophic hormone with a role in testicular descent in fetal life. Is a ligand for LGR8 receptor (By similarity).
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  Rxfp2, Rxfp1
  • Target Unid:  Q5ECL0, Q6R6I6
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  45945
  • Structure ID:  AF-Q9WUK0-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor006504_AF2.pdbhor006504_ESM.pdb

Physical Information

Mass: 318731 Formula: C112H186N36O36S4
Absent amino acids: EFIKMWY Common amino acids: CL
pI: 7.29 Basic residues: 3
Polar residues: 11 Hydrophobic residues: 8
Hydrophobicity: 26.92 Boman Index: -2341
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 90
Instability Index: 3983.85 Extinction Coefficient cystines: 250
Absorbance 280nm: 10

Literature

  • PubMed ID:  10542371
  • Title:  Structure and expression of the rat relaxin-like factor (RLF) gene.