HORDB

General Information

ID: hor006497
Uniprot ID: Q9VLK4
Protein name: Diuretic hormone class-II
Gene name: Dh31
Organism: Drosophila melanogaster (Fruit fly)
Family: Diuretic hormone class 2 family
Source: Animal
Expression: NA
Disease: NA
Comments: NA
Taxonomy: melanogaster subgroup , melanogaster group , Sophophora (subgenus), Drosophila (genus), Drosophilini (tribe), Drosophilinae (subfamily), Drosophilidae (family), Ephydroidea (superfamily), Acalyptratae , Schizophora , Cyclorrhapha , Eremoneura , Muscomorpha (infraorder), Brachycera (suborder), Diptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia , Insecta (class), Hexapoda (subphylum), Pancrustacea , Mandibulata , Arthropoda (phylum), Panarthropoda , Ecdysozoa , Protostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
GO MF: GO:0001664 G protein-coupled receptor binding; GO:0005179 hormone activity; GO:0008613 diuretic hormone activity
GO BP: GO:0007186 G protein-coupled receptor signaling pathway; GO:0007189 adenylate cyclase-activating G protein-coupled receptor signaling pathway; GO:0007589 body fluid secretion; GO:0007619 courtship behavior; GO:0009266 response to temperature stimulus; GO:0010841 positive regulation of circadian sleep/wake cycle, wakefulness; GO:2000252 negative regulation of feeding behavior
GO CC: GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0005737 cytoplasm

Sequence Information

Sequence: TVDFGLARGYSGTQEAKHRMGLAAANFAGGP
Length: 31(76-106)
Propeptide: MTNRCACFALAFLLFCLLAISSIEAAPMPSQSNGGYGGAGYNELEEVPDDLLMELMTRFGRTIIRARNDLENSKRTVDFGLARGYSGTQEAKHRMGLAAANFAGGPGRRRRSETDV
Signal peptide: MTNRCACFALAFLLFCLLAISSIEA
Modification: T31 Proline amide
Glycosylation: NA
Mutagenesis: NA

Activity

Function: Regulation of fluid secretion. Stimulates Malpighian tubules fluid secretion by activating the apical membrane V-ATPase via cyclic AMP of principal cells in the main secretory segment.
Mechanism: NA
Cross BBB: NA
Target: Dh31-R
Target Unid: A0A0B4KF12
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure

Disulfide bond: NA
Structure ID: AF-Q9VLK4-F1(AlphaFold_DB_ID)

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor006497_AF2.pdb

hor006497_ESM.pdb

Physical Information

Mass:	368681	Formula:	C137H212N42O42S
Absent amino acids:	CIW	Common amino acids:	AG
pI:	9.3	Basic residues:	4
Polar residues:	11	Hydrophobic residues:	11
Hydrophobicity:	-24.19	Boman Index:	-3775
Half-Life:	7.2 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	>10 hour	Aliphatic Index	53.87
Instability Index:	-290.65	Extinction Coefficient cystines:	1490
Absorbance 280nm:	49.67

Literature

PubMed ID: 10731132
Title: The genome sequence of Drosophila melanogaster.
PubMed ID: 12537572
Title: Annotation of the Drosophila melanogaster euchromatic genome: a systematic review.
PubMed ID: 21214272
Title: Peptidomics and peptide hormone processing in the Drosophila midgut.
PubMed ID: 11316500
Title: The Drosophila melanogaster homologue of an insect c