General Information

  • ID:  hor006497
  • Uniprot ID:  Q9VLK4
  • Protein name:  Diuretic hormone class-II
  • Gene name:  Dh31
  • Organism:  Drosophila melanogaster (Fruit fly)
  • Family:  Diuretic hormone class 2 family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   melanogaster subgroup , melanogaster group , Sophophora (subgenus), Drosophila (genus), Drosophilini (tribe), Drosophilinae (subfamily), Drosophilidae (family), Ephydroidea (superfamily), Acalyptratae , Schizophora , Cyclorrhapha , Eremoneura , Muscomorpha (infraorder), Brachycera (suborder), Diptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia , Insecta (class), Hexapoda (subphylum), Pancrustacea , Mandibulata , Arthropoda (phylum), Panarthropoda , Ecdysozoa , Protostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0001664 G protein-coupled receptor binding; GO:0005179 hormone activity; GO:0008613 diuretic hormone activity
  • GO BP:  GO:0007186 G protein-coupled receptor signaling pathway; GO:0007189 adenylate cyclase-activating G protein-coupled receptor signaling pathway; GO:0007589 body fluid secretion; GO:0007619 courtship behavior; GO:0009266 response to temperature stimulus; GO:0010841 positive regulation of circadian sleep/wake cycle, wakefulness; GO:2000252 negative regulation of feeding behavior
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0005737 cytoplasm

Sequence Information

  • Sequence:  TVDFGLARGYSGTQEAKHRMGLAAANFAGGP
  • Length:  31
  • Propeptide:  MTNRCACFALAFLLFCLLAISSIEAAPMPSQSNGGYGGAGYNELEEVPDDLLMELMTRFGRTIIRARNDLENSKRTVDFGLARGYSGTQEAKHRMGLAAANFAGGPGRRRRSETDV
  • Signal peptide:  MTNRCACFALAFLLFCLLAISSIEA
  • Modification:  T31 Proline amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Regulation of fluid secretion. Stimulates Malpighian tubules fluid secretion by activating the apical membrane V-ATPase via cyclic AMP of principal cells in the main secretory segment.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  Dh31-R
  • Target Unid:  A0A0B4KF12
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q9VLK4-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006497_AF2.pdbhor006497_ESM.pdb

Physical Information

Mass: 368681 Formula: C137H212N42O42S
Absent amino acids: CIW Common amino acids: AG
pI: 9.3 Basic residues: 4
Polar residues: 11 Hydrophobic residues: 11
Hydrophobicity: -24.19 Boman Index: -3775
Half-Life: 7.2 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 53.87
Instability Index: -290.65 Extinction Coefficient cystines: 1490
Absorbance 280nm: 49.67

Literature

  • PubMed ID:  10731132
  • Title:  The genome sequence of Drosophila melanogaster.
  • PubMed ID:  12537572
  • Title:  Annotation of the Drosophila melanogaster euchromatic genome: a systematic review.
  • PubMed ID:  21214272
  • Title:  Peptidomics and peptide hormone processing in the Drosophila midgut.
  • PubMed ID:  11316500
  • Title:  The Drosophila melanogaster homologue of an insect calcitonin-like diuretic peptide stimulates V-ATPase activity in fruit fly Malpighian tubules.