General Information

  • ID:  hor006494
  • Uniprot ID:  Q9ULZ1
  • Protein name:  Apelin-31
  • Gene name:  APLN
  • Organism:  Homo sapiens (Human)
  • Family:  Apelin family
  • Source:  Human
  • Expression:  Expressed in the brain with highest levels in the frontal cortex, thalamus, hypothalamus and midbrain . Secreted by the mammary gland into the colostrum and the milk.
  • Disease:  Diseases associated with APLN include Intracranial Arteriosclerosis and Heart Disease.
  • Comments:  NA
  • Taxonomy:   Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005102 signaling receptor binding; GO:0005179 hormone activity; GO:0031704 apelin receptor binding
  • GO BP:  GO:0001525 angiogenesis; GO:0006955 immune response; GO:0007165 signal transduction; GO:0007369 gastrulation; GO:0007595 lactation; GO:0010629 negative regulation of gene expression; GO:0040037 negative regulation of fibroblast growth factor receptor signaling pathway; GO:0042756 drinking behavior; GO:0045776 negative regulation of blood pressure; GO:0045823 positive regulation of heart contraction; GO:0060183 apelin receptor signaling pathway; GO:0060976 coronary vasculature development; GO:1902895 positive regulation of miRNA transcription; GO:1904022 positive regulation of G protein-coupled receptor internalization; GO:1904706 negative regulation of vascular associated smooth muscle cell proliferation; GO:1905564 positive regulation of vascular endothelial cell proliferation
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  GSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF
  • Length:  31(47-77)
  • Propeptide:  MNLRLCVQALLLLWLSLTAVCGGSLMPLPDGNGLEDGNVRHLVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF
  • Signal peptide:  MNLRLCVQALLLLWLSLTAVCG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Endogenous ligand for the apelin receptor (APLNR) (PubMed:10525157). Drives internalization of the apelin receptor (By similarity). Apelin-36 dissociates more hardly than (pyroglu)apelin-13 from APLNR (By similarity). Hormone involved in the regulation of
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  APLNR
  • Target Unid:   P35414
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q9ULZ1-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006494_AF2.pdbhor006494_ESM.pdb

Physical Information

Mass: 413739 Formula: C157H250N60O37S
Absent amino acids: ACDEITVY Common amino acids: R
pI: 13.28 Basic residues: 10
Polar residues: 9 Hydrophobic residues: 4
Hydrophobicity: -176.13 Boman Index: -12352
Half-Life / Aliphatic Index: 30 hour Aliphatic Index: 12.58
Instability Index: 8787.74 Extinction Coefficient cystines: 5500
Absorbance 280nm: 183.33

Literature

  • PubMed ID:  9792798
  • Title:  Isolation and characterization of a novel endogenous peptide ligand for the human APJ receptor.
  • PubMed ID:  10525157
  • Title:  Apelin, the natural ligand of the orphan receptor APJ, is abundantly secreted in the colostrum.
  • PubMed ID:  10617103
  • Title:  Characterization of apelin, the ligand for the APJ receptor.#
  • PubMed ID:  15772651
  • Title:  
  • PubMed ID:  15489334
  • Title:  
  • PubMed ID:  11090199
  • Title: